Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home About Us
About Us

All praise is due to Allaah and may prayers and salutations be upon the Messenger. To proceed:

Following sound faith (eemaan) and pure monotheism (tawheed), one of the greatest assets that a Muslim can have is good health. Good health facilitates the fulfilment of the religious and worldly obligations. It empowers a Muslim to do good deeds for his or her own benefit and for the benefit of the society at large. It makes a Muslim productive and optimistic and this only brings further benefits to the society as a whole.

Ibn al-Qayyim, a chapter heading, "His (sallallaahu `alayhi wasallam's) Guidance Concerning health," states the following:

Since health is one of the most precious favours Allaah has given to His servants, the most generous of His gifts, and most plentiful of His bounties, nay more, absolute health is the most precious of all favours, without exception - it is fitting that whoever is granted a portion of this good fortune, to cherish, preserve and to guard it against harm. Bukhari has related in his Saheeh form the hadeeth of Ibn Abaas: The Messenger (sallallaahu alayhi wa sallam) said, "There are two favours about which many people are not aware: health (sihhah) and faraagh (free time, leisure)" ... (Zaad al-Ma'aad 4/196).

To this end, HealthyMuslim.Com is a growing online resource that aims to provide coverage on all aspects of health, nutrition and disease with a specific focus on natural health (diet and lifestyle) and sound principles of nutrition. As our bodies are a trust, then it is a religious obligation to maintain them to the best of our abilities.

Ibn al-Qayyim, the noted Muslim scholar stated that the principles of sound health are three:

  • preservation of good health
  • removal of harmful substances from the body and
  • keeping the body away from harm.

In a modern context this equates to eating wholesome nutritious foods, ensuring balance of quality and quantity, keeping away from things that are toxic and harmful to the body (and in modern society there are many), and striving to detoxify the body from the consequences of bad diet and lifestyle and exposure to harmful elements.

The content on HealthyMuslim.Com will be largely based around these principles, and will include details of new research as well as established solid principles of nutrition.

It is our firm belief that modern (Western) medicine, whilst certainly having positive aspects in a number of areas, does little to treat or cure, by and large, the true underlying causes of diseases and chronic illnesses. It is mostly centered around the treatment of symptoms, that is, to manage disease symptoms. This leads to the continued use and reliance upon prescription drugs with the true underlying causes of the disease never really being addressed. This model of disease treatment is structured in order to facilitate the exploitation of disease conditions and states for profitable pharmacological agents.

Allen Rose, the worldwide vice-president of GlaxoSmithKline, admitted in 2003 in public, that 90% of all drugs, whether produced by his company or not, do not work in the majority of people. That's straight from the horses mouth. That does not mean that some drugs do not have any value, it just simply means that the idea that was pushed for most of the twentieth century (and still is) that absence of disease is synonymous with use of pharmacological agents is not correct. In fact, such a belief is an aberration in the many thousands of years of the history of medicine, whose foundation has always been in diet, nutrition and lifestyle. The greatest of modifiable influences upon disease are diet, nutrition and lifestyle (which are from the asbaab [ways and means], and this is after consideration of the role of al-qadaa wal-qadar within which are the asbaab).

Despite billions and billions being poured into what we are told is "objective scientific research" diseases and illnesses only increase in occurrence and major breakthroughs are never in the horizon. cancer, diabetes, heart disease and myriads of other diseases and ailments increase day by day. The true and real reasons for all of these failings of the body come back down - in the overwhelming majority of disease conditions - to the principles of nutrition, diet, state of mind, and lifestyle, after the decree of Allaah, the Exalted.

We will be publishing what in our estimation is the most credible and sound advice for maintenance of good health in light of the principles of:

  • prevention before cure,
  • sound nutrition,
  • wholesome eating and
  • healthy living

We hope that by way of this resource you are able to better understand the principles of nutrition and are able to make good sound decisions that will impact positively on your own health and the health of your children. Please try to spread this site as far and wide as possible in order to maximize the benefit.

Amjad bin Muhammad Rafiq
BSc Medicinal Biochemistry
PhD Biochemistry
Saeed bin Salih
BSc, PhD Medicinal Biochemistry
Pharmaceutical R&D, GlaxoSmithKline (Previously)

Important Notes

  1. We will be quoting specific medicinal treatments from the Sunnah and the Prophetic medicine. These are clearly associated with Islaam and the Sunnah and clearly fall into the domain of Islamic rulings (in terms of permissibility and recommendation), and these are clearly indicated within the articles.

  2. We will be bringing general issues of nutrition, the benefits (and in some cases, harms) of a variety of foodstuffs. Some of them are mentioned in the Sunnah, and others are mentioned by Ibn al-Qayyim in his book, "the Prophetic Medicine", and others do not have a mention. Whilst these are not specifically mentioned in the Sunnah, and cannot be said to be specifically from the Prophetic medicine, they would nevertheless come under the general principles of health outlined by Ibn al-Qayyim such as preservation of i) good health (via good diet and relevant foodstuffs) and ii) not subjecting the body to what is harmful.

  3. We will also be bringing information of importance relating to contemporary issues. These matters are presented for the purposes of information and education on issues that do impact upon health. To illustrate this: The dangers of a variety of harmful substances or of radiation (such as from mobile and cellphone use) for example, are issues that directly impact upon health. So if we present information in this regard, it should be understood that this is something that the general principles of health (as explained by Ibn al-Qayyim) would relate to, and any recommendations or advice given should not be understood as being a specific position, ruling or fatwa tied to Islaam, the Sunnah or the Prophetic medicine. Rather, it is merely information sharing and a recommendation of courses of action which in our view - in light of the presented evidences - would be conducive and beneficial to health and well-being and can be said to be in line with the general principles of health that the Scholars have derived from the Sunnah. These are to be taken as our viewpoints and opinions and not considered Islamic rulings or injunctions.






Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use