Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Tea Contains Health-Promoting Polyphenols
Posted by SoundHealth, in Nutrition
Topics: Tea Green Tea Polyphenols

  Mail To Friend    Printer Friendly Bookmark and Share

From green, black and white, teas are packed full of flavonoids and other health beneficial antioxidants. Studies have associated some teas with relieving conditions like cancer, heart disease, and diabetes; encouraging weight loss; and bringing about mental alertness.

"tea" can refer to any number of beverages including herbals like mint or chamomile. But 'true' tea that is packed with beneficial antioxidants is made from the leaves, stems and buds of the Camellia sinensis plant. This includes the varieties black, green, white or oolong tea, which all come from this bush. The difference between the teas is how they are processed. "green tea" is made from leaves that are dried right after harvesting, while the leaves used to make black tea are fermented for a short time. White tea leaves do not undergo any oxidation and are shielded from the sun and not allowed to produce any chlorophyll.

Health Benefits of Tea

Tea is a good source of flavonoids called catechins, which are important antioxidants that are associated with helping to prevent certain diseases. The majority of these catechins are found in green tea and include epigallocatechin-3-gallate (EGCG), the most abundant and widely studied tea polyphenol.

All of these teas contain caffeine and theanine (an amino acid), which affect the brain, and have shown to heighten mental alertness. Caffeine levels tend to be higher in tea bag forms (the finer grind releases more caffeine).

The more processed the tea leaves, usually the less polyphenol content. As oolong and black teas are oxidized or fermented, they have lower concentrations of polyphenols than green tea; but their antioxidizing power is still high.

Here's what some studies have found about the potential health benefits of tea:

Green tea: Made with steamed tea leaves, it has a high concentration of EGCG and has been widely studied. The antioxidants in green tea as associated with relieving conditions varying from simple viral or bacterial infections, to degenerative conditions including cancer, cardiovascular disease, stroke, osteoporosis and periodontal disease. Green tea has also shown to alleviate symptoms of illnesses such as diabetes, liver disease and arthritis.

Black tea: Made with fermented tea leaves, black tea has the highest caffeine content and forms the basis for flavored teas like chai, along with some instant teas. Studies have linked the consumption of black tea along with green tea in helping to reduce the risk of heart disease, by improving endothelial function (keeping the lining of the arteries open to allow more blood flow) and lowering blood pressure. The major polyphenols of black tea and green tea have also been shown to inhibit proteins which are closely associated with cancer tumor growth and metastasis (the spreading of cancer cells from one organ or tissue to another).

White tea: This is uncured and unfermented tea, and one study showed that white tea has the most potent anticancer properties compared to more processed teas.

Boosts insulin activity: a study from the US found that green, black and oolong teas increased insulin activity by about fifteen-fold in tests using fat cells obtained from rats.

Weight loss: Preliminary research findings suggest that drinking tea has an effect on weight and fat accumulation in the body. Researchers found that green tea extract significantly increased energy expenditure and fat oxidation, and resulted in weight loss of modestly obese patients.

Herbal Teas

Herbal tea is not really tea; it is an infusion of herbs, fruits, flowers, seeds, or roots. As these infusions do not come from the Camellia plant, they therefore do not have its health promoting benefits. Their chemical compositions of herbal infusions vary widely depending on the plant used, but they do promote various other health qualities, and have relaxing and calming effects. Another advantage is that they are caffeine-free.

Common varieties include: ginger, chamomile, ginkgo biloba, ginseng, hibiscus, jasmine, rosehip, mint, rooibos (red tea), and echinacea.

Limited research has been done on the health benefits of herbal teas, but here are some of the findings:

Chamomile tea: Its antioxidants are associated with helping prevent complications from diabetes, like loss of vision and nerve and kidney damage, and stunt the growth of cancer cells.

Hibiscus tea: A small study found that drinking three cups of hibiscus tea daily lowered blood pressure in people with modestly elevated levels.

Rooibos (red tea): This is a South African herb that is fermented. Although it has flavonoids with cancer-fighting properties, medical studies have been limited.

Tips on Using Tea

  • Instant tea generally contains very little amounts of actual tea and therefore out of all the forms of tea, it has the least amount of health-promoting catechins.

  • Green and white teas are best brewed at lower temperatures (around 80 degrees Fahrenheit), because if the water is too hot the leaves will burn, leaving a bitter taste.

  • Black tea should be allowed to steep for about five minutes for the best flavor, and eighty percent of the catechins are released by the five-minute mark.

References

  • Henning SM, Niu Y, Lee NH, Thames GD, Minutti RR, Wang H, Go VLW, Heber D. Bioavailability and antioxidant activity of tea flavonols after consumption of green tea, black tea, or a green tea extract supplement. Am J Clin Nutr. 2004;80:1558-1564.

  • Arts IC, Jacobs DR Jr, Gross M, et al. Dietary catechins and cancer incidence among postmenopausal women: the Iowa Womens health Study (United States). Cancer Causes Control. 2002;13(4):373-382.

  • Conney AH, Lu Y, Lou Y-R, et al. Inhibitory effect of green and black tea on tumor growth. Proc Soc Exp Biol Med. 1999;220:229-233.

  • Hakim IA, Harris RB. Joint effects of citrus peel use and black tea intake on the risk of squamous cell carcinoma of the skin. BMC Dermatol. 2001;1:3.

  • Dora I, Arab L, Martinchik A, et al. Black tea consumption and risk of rectal cancer in Moscow population. Ann Epidemiol. 2003;13(6):405-411

  • Isemura M, Saeki K, Kimura T, et al. Tea catechins and related polyphenols as anti-cancer agents. Biofactors. 2000;13(1-4):81-85.

  • Cabrera C, Artacho R, Gimenez R. Beneficial effects of green tea--a review. J Am Coll Nutr. 2006 Apr;25(2):79-99. Review.

  • Yang YC, Lu FH, Wu JS, et al. The protective effect of habitual tea consumption on hypertension. Arch Intern Med. 2004;164(14):1534-1540.

  • Arts ICW, Hollman PCH, Feskens EJM, Bueno de Mesquita HB, Kromhout D. Catechin intake might explain the inverse relation between tea consumption and ischemic heart disease: The Zutphen Elderly Study. Am J Clin Nutr. 2001;74:227-232.

  • Nagao T, Komine Y, Soga S, Meguro S, Hase T, Tanaka Y, and Tokimitsu I. Ingestion of a tea rich in catechins leads to a reduction in body fat and malondialdehyde-modified LDL in men. Am J Clin Nutr.2005;81:122-129.

  • Hegarty VM, May HM, Khaw K-T. Tea drinking and bone mineral density in older women. Am J Clin Nutr 2000;71:1003-7.

  • Anderson RA, Polansky MM. Tea enhances insulin activity.J Agric Food Chem. 2002 Nov 20;50(24):7182-6.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use