Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Why the Sweetener Aspartame Is a Deadly Toxin
Posted by SoundHealth, in Nutrition
Topics: Aspartame Sweetener Monosodium Glutamate Phenylalanine

  Mail To Friend    Printer Friendly Bookmark and Share

Aspartame, an artificial sweetener found in diet sodas and other sugar-free foods, is one of the most toxic substances that is added to food. This sweetener, commonly marketed under brand names like NutraSweet or Equal, generally appears to cause slow, silent damage to health that accumulates over the years, through long-term use. aspartame, like the flavor enhancer monosodium glutamate is a neurotoxin and has been linked to causing over 90 different side effects ranging from headaches, seizures, memory loss, joint pain, brain tumors, and even death. It has been linked to physical, visual and mental problems, and mimics the symptoms or worsens the condition of various diseases.

Aspartame and brain Tumors

When aspartame is exposed to heat or prolonged storage, it breaks down into metabolites (substances produced by metabolism). One of these breakdown products is Diketopiperazine (DKP), a toxic metabolite that is not usually found in our diet. The effects of these different metabolites are unknown, but DKP has been implicated in the occurrence of brain tumors. It was found that when this substance was converted in the gut, it produced a compound similar to that of a powerful brain-tumor causing chemical.

In a two-year study conducted by the manufacturer of aspartame, twelve of the 320 rats tested fed a normal diet and aspartame, developed brain tumors while none of the control rats had tumors. Five of the twelve tumors were in rats given a low dose of aspartame.

It is true that aspartame is composed of the same amino acids that can be found in protein foods. However, there are only two amino acids, phenylalanine and aspartic acid, that are in aspartame while protein foods contain many different amino acids. When aspartame is ingested, it floods the bloodstream with these two amino acids while protein foods, on the other hand, have other amino acids which "neutralize" and eliminate this sudden flooding. It is thought that taking amino acids out of their natural form cause problems and adverse reactions. A closer look at aspartame's ingredients and its adverse reactions reveal the dangers of this artificial sweetener.

How aspartame Causes Damage

Aspartame is made up of three chemicals: Aspartic acid (40%), phenylalanine (50%), and methanol (10%).

Aspartic acid (40% of Aspartame)

Both aspartate (aspartic acid) and glutamate (found in the flavor enhancer monosodium glutamate) are amino acids and work in the same way in the body. They act as neurotransmitters in the brain by aiding the transmission of information from neuron to neuron. Too much aspartate or glutamate in the brain kills certain neurons by allowing an influx of calcium into the cells. This influx triggers excessive amounts of free radicals, which kill the cells. This neural cell damage that can be caused by excessive aspartate and glutamate is why they are referred to as excitotoxins. They "excite" or stimulate the neural cells to death.

Because aspartate and glutamate are amino acids, when they are ingested in their free form (unbound to proteins), they significantly raise blood plasma levels of these chemicals. This excess leads to a high level of those neurotransmitters in certain areas of the brain.

Usually the blood brain barrier protects the brain from excess glutamate and aspartate as well as from other toxins. However in children it is not fully developed, or it can become damaged by numerous chronic and acute conditions, which can allow leakage of excess glutamate and aspartate into the brain. This excess glutamate and aspartate slowly begins to destroy neurons. The large majority (75% or more) of neural cells in a particular area of the brain are killed before any symptoms of a chronic illness are even noticed. Some of the many chronic illnesses that have been shown to be contributed to by long-term exposure to excitotoxin damage include:

Multiple sclerosis (MS), motor neuron disease, hearing loss, epilepsy, Alzheimer's disease, Parkinson's disease, hypoglycemia, dementia, brain lesions, and neuroendocrine disorders.

Phenylalanine (50% Of Aspartame)

Phenylalanine is an amino acid normally found in the brain. People with the genetic disorder, phenylketonuria (PKU) cannot metabolize phenylalanine, leading to dangerously high levels of phenylalanine in the brain. But even in people who do not have this disorder, it has been shown that ingesting aspartame can lead to an overload of phenylalanine in the brain.

Excessive levels of phenylalanine in the brain are associated with causing levels of seratonin in the brain to decrease, leading to emotional disorders such as depression, schizophrenia and brain damage. It was shown in human testing that phenylalanine levels of the blood were increased significantly in human subjects who chronically used aspartame. But even a single use of aspartame raised the blood phenylalanine levels, which is especially dangerous for infants and fetuses. Another study showed that phenylalanine is metabolized much more efficiently by rodents than by humans.

Methanol (10% of Aspartame)

Methanol, also known as methyl alcohol or wood alcohol, forms 10% of aspartame, and is a deadly poison. Free methanol, such as that formed from aspartame when it is heated or stored for a long time, breaks down into formic acid and formaldehyde in the body. Formaldehyde is a known deadly neurotoxin. The recommended Environmental Protection Agency limit of consumption is 7.8 mg/day. A one-liter aspartame-sweetened beverage contains about 56 mg of methanol.

Formaldehye is also a known carcinogen, is also linked to causing blindness, retinal damage, interfering with DNA, and causing birth defects. Due to the lack of a few key enzymes, humans are many times more sensitive to the toxic effects of methanol than animals. Therefore, tests of aspartame or methanol on animals do not accurately reflect the danger for humans.

Eliminate aspartame from Your diet

Despite all of these harmful effects, aspartame is an "approved sweetener" and is found in many common foods and drinks. To protect yourself from the damaging effects of this toxin, eliminate it from your diet. Aspartame is sometimes labeled as phenylalanine in foods. It can be found in:

  • soft drinks, usually diet soft drinks
  • sugar-free chewing gum and breath mints
  • crisps
  • instant breakfasts
  • cereals
  • desserts
  • juice beverages
  • multivitamins
  • milk drinks
  • pharmaceuticals
  • tabletop sweeteners
  • yogurt
and many other foods.

Some Research Findings on Aspartame:

  • Stegink, L.: Filer, L.J. Jr. Aspartame Physiology and Biochemistry. University of Iowa College of medicine. Iowa City, IA Marcel Dekker, Inc. 1984.

  • Boehm, M.: Bada, J. Racemization of aspartic acid and phenylalanine in the sweetener aspartame at 100 degrees C. Proc. Natl. Acad. Sci. USA (81) August 1984.

  • Walton, R. G. "Seizure and mania after high intake of aspartame." Psychopathology 17:98-106 (1984)

  • Drake, M.E. "Panic Attacks and Excessive aspartame Ingestion." The Lancet (Sept 13, l986) p. 631

  • Walton, R. G. "The Possible Role of aspartame in Seizure Induction" Proceedings of the First International Meeting on Dietary phenylalanine and brain Function. (May 8-10 1987) pp.495-499

  • Epstein, C. M.: Trotter, J.F.: et al "EEG Mean Frequencies are Sensitive indices of phenylalanine Effects on Normal brain." Electroencephalography and Clinical Neurophysiology 72:133-139 (1989)

  • Pinto, J.M.B." Maher, T. J. "Administration of aspartame Potentiates Pentlyeneterazole and Fluorothyl-Induced Seizure in Mice." Neuropharmacology 27 (1):51-55 (l988)

  • Olney, John "Excitatory Neurotoxins as Food Additives: An Evaluation of Risk." Neurotoxicology 2:163-192 (1980)

  • Koehler S.M.: Glaros, A. "The effect of aspartame on migraine headache." headache 28:000-000 (l988)

  • Edmeada, J. Editorial: "Aspartame and headache." headache, pp.64-65 (February, 1988)

  • Lipton, R. B.; Newman, L. C.: Solomon, S. "Aspartame and headache, (re:Schiffman et al study)," New England Journal of medicine 318 (18): 1200-1201 (May 5, 1988)

  • Steinmetzer, R.V.: Kunkel, R.S. "Aspartame and Headache" New England Journal of medicine 318 (18): 1201 (May 5, 1988)

  • Koehler, Shirley; and Glaros, Alan. "The Effect of aspartame on migraine headache." headache 28 (1):10-14 (l988)

  • Olney, J. W.; and Ho, Ol. "Brain damage in Infant Mice Following Oral Intake of Glutamate, Aspartate or Cysteine." Nature 227:609-611 (August 8, 1970)

  • Olney, J. W. "Excitotoxic food additives - Relevance of Animal Studies to Human Safety." Neurological Behavioral Toxicology and Teratology 6:455-462 (l984).

  • Olney, J. W.; Labruyere, J: DeGubaret, T. "Brain Damage in Mice from Voluntary Ingestion of Glutamate and aspartame." Neurobehavioral Toxicology 2:125-129 (l980)

  • Roberts, H. J. "Does aspartame Cause Human brain cancer?" Journal of Advances in medicine 4 (4): 231-241 (Winter, 1991).

  • Potenza, D." El-Mailakh, Rif S. "Aspartame: Clinical Update." Connecticut Medical Journal 53 (7): 395-400 (l989)

  • Sardesai, V.M.: Holliday, J.F.; et al. "Effect of aspartame in Normal and Diabetic Rats." Biochemical Archives 2:237-243 (l986)

  • Yokigoshi, H.: Roberts, C. F>: Caballero, B.: Wurtman, R. J. "Effects of aspartame and glucose Administration on brain and Plasma Levels of Large Neutral amino acids and brain 5-Hydroxyindoles." American Journal of Clinical nutrition. 40:1-7 (July 1, 1984)

  • Krause, W.:Halminksi, M." et al. "Biochemical and Neuropsychological Effects of Elevated Plasma phenylalanine in Patients with Treated Phenylketonuria." Journal of Clinical Investigation 75: 40-48 (January, 1985).

  • Pardridge, W.M. "Potential Effects of the Dipeptide sweetener aspartame on the brain. Nutrition and the brain 7:199-241 (l986)

  • Gaines, S. M.: Bada, J.I. "Reversed Phase, High-Performance Liquid Chromatographic Separation of aspartame Diastereomeric Decomposition Products." Journal of Chromatography. 389-:219-225 (l987)

  • Filer, L. J.; Stegnink. L.D. "Effect of aspartame on Plasma phenylalanine concentration in Humans." Proceedings of the First International Meeting on Dietary phenylalanine and the brain Function (May 8-10, l987) pp 25-26

  • Matalon, R.: Michals, K.:et al. "Aspartame Consumption in Normal Individuals and Carriers for Phenylketonuria (PKU)." Proceedings of the First International Meeting on Dietary phenylalanine and brain Function (May 8-10, l987) pp. 81-93

  • Matalon, R. Michals, K." Sullivan, D.; et al. "Aspartame Consumption in Normal Individuals and Carriers for Phenylketonuria (PKU)." University of Illinois at Chicago, Department of Pediatrics, nutrition and Medical Dietetics and Epidemiology and Biometry, Chicago, Illinois (l986).

  • Tocci, P.M.: Beber, B. "Anomalous phenylalanine Loading Responses in Relation to Cleft Lip and Cleft Palate." Pediatrics 52: 109-113 (July l973)

  • Blundell, J.E.: Hill, A.H. "Paradoxical Effects of an Intense sweetener (aspartame) on Appetite." The Lancet (May 10, l986) pp. l092-1093.

  • Garriga, M., MD; and Metcalf, D.,MD. "Aspartame intolerance" Annals of allergy 61:63-66 (December 1988)

  • Council Report: aspartame review of safety issues. Journal of the American Medical Association l985:254 (3):400

  • Novick, N.J. "Aspartame-induced granulomatous panniculitis." Annals of Internal medicine 102:206-207 (l985)

  • McCauliffe, D.: and Poitras, K. "Aspartame-induced lobular panniculitis." J of the American Academy of Dermatology 24 (2):298-299 (February 1991)

  • Kulezycki,A.Jr. "Aspartame induced urticaria. Annals of Internal medicine 104:207-208 (l986)

  • Wurtman, R.J. "Aspartame: possible effect on seizure susceptibility." Lancet 2:1060. (l985)

  • Schainker, N. and Olney, J.W. "Glutamate Type Hypothalamic Pituitary Syndrome in Mice Treated with aspartame or Cysteate in Infancy." Journal of Neutral Trans. 35: 207-215 (l974)

  • Reynolds, W. A.: Butler, V." Lemley-Johnson, N. "Hypothalamic Morphology Following ingestion of aspartame of MSG in the Neonatal Rodent and Primate: A Preliminary Report" Journal of Toxicology and Environmental health 2:471-480 (l976)

  • Pizzi, W.J.:Tabor, J.M.:Barnhart,J. "Somatic, Behavioral and Reproductive Disturbances in Mice Following Neonatal Administration of sodium L-Aspartate." Pharmacological Biochemical Behavior 9::481-485 (l976)

  • Stegnik, L.D.: Brummel, M.C.; et al, "Blood Methanol Concentrations in Normal Adult Subjects Administered Abuse dose of aspartame." J of Toxicological Environmental health 7:281-290 (l981)

  • Monte, Woodrow, "Aspartame: Methanol and the Public health," Journal of Applied nutrition 36(1):42-54 (l984).

  • Bergeron, R.:Cardinal, J." et al. "Prevention of Methanol Toxicity by Ethanol Therapy." New England Journal of medicine (December 9, 1982) pp. 1528

  • Tsang, W.S.;Clarke, M.A.; Parrish, F.W. "Determination of aspartame and Its Breakdown Products in soft drinks by Reverse-Phase Chromatography with UV Detection." Journal of Agricultural Fd. Chemicals 33:734-738 (l985)

  • Davoli, E.; Cappeilini, L.' et al. "Serum Methanol Concentrations in Rats and in Men after a Single Dose of aspartame." Fed. Chemical Toxicology 24 (3):187-189 (l986).

  • Wurtman, R.J. "Neurochemical Changes Following High Dose aspartame with Dietary carbohydrates." New England Journal of medicine 309:7 (August 18, 1982).

  • Sharma, R.P.; Coulombe, R.A., Jr. "Effects of Repeated Doses of aspartame on serotonin and its Metabolite in Various Regions of the Mouse brain." Toxicology Program, Department of Animal, Dairy and Veterinary Sciences. Utah State University. (l986).

  • Padridge, W.M. "The Safety of aspartame." J of the American Medical Association 256 (19):2678. (November 21, l986).

  • Walton, R.G.: Hudak, R.: and Green-Waite, R.J. "Adverse Reactions to Aspartame: Double-blind Challenge in Patients from a Vulnerable Population." Biological Psychiatary pp. 13-17 (l993).

  • Millstone, E. "Sweet and Sour: The Unanswered Questions about aspartame." The Scoiogist Volume 24, Number 2 (March/April 1994).


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use