Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Ways to Improve Digestion
Posted by SoundHealth, in Nutrition
Topics: Food Combining Protein Starch Digestion

  Mail To Friend    Printer Friendly Bookmark and Share

Correctly combining foods is associated with considerably improving digestion. Good digestion is crucial for our long-term health and well-being. If we don't digest and absorb nutrients from our food properly, every bodily function can be affected.

Digestion is not just about getting food in and out; it is the absorption and assimilation of nutrients for the nourishment of the whole body, as well as construction and repair of cells.

Food combining has been found to improve digestive malfunctions like indigestion, heartburn, bloating, constipation and flatulence, as well as easing symptoms of more complicated gut disorders like irritable bowel syndrome, ulcers, colon cancer, etc.

Many of these problems are often related to food in some way, and can be resolved by watching what we eat and how we eat it.

For optimal digestion and superior health, here are some digestive rules:

Don't Over-Eat

Our stomach and digestive system have limits and can only handle so much food. The body can function on a third of its daily food intake and over-consumption of food is the major cause of indigestion, and leads to obesity and many chronic diseases.

Remember the hadeeth:

Miqdaam bin Ma'dee Karib said: I heard the Messenger of Allah (sallallahu 'alayhi wasallam) say: "The son of Adam does not fill a container worse than his stomach. Sufficient is it for the son of Adam to take enough morsels (of food) to keep his back straight. And if it is necessary, then a third for his food, a third for his drink and a third for his breath." [Ibn Maja, At'ima, 50]

Establish Regular eating habits

Food that is eaten late at night sits in the stomach and gets poorly digested because the digestive organs are in their rejuvenation and resting phase. Also, when you lie down straight after a meal, the secretion of digestive enzymes is reduced because the body is in a horizontal position. Aim to eat your final main meal of the day at least 3 hours before going to bed, to allow sufficient time for the food to be processed.

It is important to eat meals at regular times and at the same time everyday. Regularly consuming the same foods also promotes good digestion. Structuring your diet around a group of foods that are routinely consumed has a regulating effect on the digestive system, as opposed to constantly adding unusual foods, which forces the digestive organs to constantly adapt.

Ideally, a diet should consist of a group of primary foods that are eaten every week, and secondary foods that are eaten alongside them, but in smaller quantities. Other foods that are unusual to you should be included in the diet perhaps once or twice a month, as they may sometimes cause digestive discomfort.

Being regular in your diet, both in timing and types of food, creates an efficient digestive system - remember regularity in means regularity out.

Eat Consciously

Consciously eating means being aware of what you are eating, and how and where it is eaten. Eat only when you are truly hungry, and know when you are full. This will significantly increase the body's ability to digest and assimilate food.

Eating too fast can also cause problems. Try to pace yourself when eating and chew more slowly. Food rushed down suffers incomplete breakdown which results in flatulence, bloating, poor absorption and vitamin deficiencies.

Ideally, eating should take place sitting down in a relaxed environment. Chewing is the first stage of the digestive process, so ensure it is done properly. Chew your food into the smallest pieces possible, as this creates more surface area on which the stomach acids can act. Large pieces of food entering the stomach cause fermentation, flatulence and indigestion.

Order of Eating

A well-ordered meal means smoother handling of the digestive system's tasks, including faster digestive times and better assimilation of nutrients. This results in less gas, bloating, heartburn and more energy.

The correct order of eating food for better digestion is to eat the easiest to digest foods before the more complex foods. Problems arise when different types of food, requiring different processing times and different enzymes, clash with foods from other groups.

Sensible order of digestion:

  • Water and juice
  • Fruit, soups and smoothies
  • Vegetables
  • Beans and grains
  • Meat, fish and poultry

Food can be categorized according to their water content, densities, and complexity of fats, carbohydrates and proteins. The denser and more complex a food, the longer it will take to pass through the digestive tract. Mixing foods of different categories complicates digestion and slows the whole system. A digestive tract that is constantly clogged up sets the stage for digestive disorders and ultimately for diseases like colitis and colon cancer.

Good food combining

Good food combining involves not mixing the different food groups in one meal. Proteins, starches, sugars, fruit etc have different chemical compositions and are therefore digested in different ways.

For example, starch digestion begins in the mouth with the salivary enzyme. However, this enzymatic action stops if a protein food is eaten at the same time. The starch then leaves the stomach in a semi-digested state and the system has to work harder to fully digest and absorb this food.

For similar reasons, fruit and sugars also inhibit the digestion of starches and proteins. Aim to eat fruit on its own, at least thirty minutes before any other food. Don't combine foods high in concentrated starches like bread and rice, with concentrated proteins like meat or fish. This is explained in more detail in the article Food Combining for Optimum Nutrition: Food Categories.

By adding a few simple changes or eliminating bad habits, our digestive efficiency can be optimized, which can result in increased energy and better health, insha'allah.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use