Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
Toronto Star Article: Few Answers to Support Fluoride Use
Posted by HealthyMuslim, in News
Topics: Fluoride Water Fluoridation

  Mail To Friend    Printer Friendly Bookmark and Share

This is another old news article in the Toronto Star from 2nd May 1999. It is now beyond doubt that fluoridation of water has no scientific backing. With that in mind, the focus is now on toothpastes as they contain fairly large dosages of fluoride. Significant amounts of fluoride are ingested through the brushing of teeth.

Some of the many high-profile detractors from fluoridation of water may still hold fluoride to be beneficial in toothpaste (in terms of local topical application not systemic ingestion - which is what occurs with fluoridated water). While there is evidence to show that fluoride in toothpaste can be of limited benefit in oral health - (fluoride kills bacteria in the mouth, but then again, so can a hundred and one natural things too) - more and more research is establishing that the benefits are of little significance compared to the toxic effects of fluoride upon the body's biochemistry. Other studies raise doubts about the extent of the purported benefits.

It's DIFFICULT to think of cavity-free teeth without thinking of fluoride. We have long been told that fluoride is good for us. It was added to Toronto's drinking water in the mid-1960s; dental associations endorsed its addition to toothpaste. But what are we to think when Canada's top pro-fluoride authority says he believes we should not be putting it into our bodies?

Dr. Hardy Limeback, biochemist and professor of dentistry at the University of Toronto, told the Sunday Star last week that parents should keep fluoride away from children under three. He added that he doesn't think adding fluoride to water is necessary and may be risky.

Limeback's change of mind is based on numerous studies, published in highly respected journals, showing strong links between fluoridated water and: weakened, brittle teeth and bones (conditions known as dental and skeletal fluorosis); cancer, lowered intelligence and Attention Deficit Disorder, early aging; genetic damage; birth defects; auto-immune disorders; and more.

Limeback is not the first fluoride expert to survey the evidence and recant. In 1980, Dr. John Colquhoun, chief dental officer of Auckland, New Zealand, examined children's dental records to help promote fluoridation. To his surprise, he found fabricated statistics and errors - but no advantage at all from fluoridation. He eventually campaigned against fluoride.

In 1973, Dr. Richard Foulkes, then consultant to the British Columbia health minister, recommended mandatory fluoridation. It never happened, but almost 20 years later, he examined dental records and discovered that the teeth of children from non-fluoridated areas were as healthy as those of children where fluoride was added to water.

Says Foulkes today:

A child's brain is vulnerable to damage from fluoride even before birth and the result can be lowered IQ ... Fluoride in drinking water may react with aluminum, to cause Alzheimer's disease.

Over 1, 100 scientists at the U.S. Environmental Protection Agency denounced fluoridation while their employer, the EPA, continued to support it. Former EPA scientist Dr. Robert Caxton, speaking on CBC TVs Marketplace in 1992, called fluoridation

the greatest case of scientific fraud of this century, if not of all time.

Very few countries fluoridate. Several, such as Sweden, Denmark and Holland, have banned fluoride. Vancouver and Montreal never bought into fluoridation. (Limeback's research shows that Torontonians have double the fluoride build-up in their hip bones as Montrealers.)

So why do we hold to the notion that fluoride is not only harmless but good for us?

Most public health officials and dental organizations - including those paid to endorse fluoride products - have never accepted the studies indicting fluoride and appear to be standing firm even in the wake of Limeback's change of position. (He was a chief fluoride adviser to the Canadian Dental Association.) The CDA, the Ontario Dental Association (ODA), the Canadian Medical Association (CMA), and health Canada still support fluoridation.

Why? In some ways, it's not entirely clear.

Without addressing the change in Limeback's position, the ODA told dentists in a release last week that "no assertion against the benefits and safety of fluoridation has ever been substantiated by scientific consensus." This may be true, but critics point out that almost no scientific issue is settled unanimously but rather based on a preponderance of evidence.

An ODA spokeswoman said this week that "the facts are clear Communal water fluoridation is safe and extremely beneficial."

But when asked to cite research that supports this, the spokeswoman said "you'll have to call health Canada ... we get all our information from them."

Health Canada said "I seriously doubt all this information came from us." The ODA did say, however, that it does no fluoridation research of its own (nor do health Canada and the CDA). The ODA doesn't even review research conducted by others.

When fluoride was being considered as an additive, a number of studies were conducted that seemed to suggest some benefits. But since then, the data has been re-examined a number of times and been found wanting.

Prominent fluoride detractor and biochemist Dr. John Yiamouyiannis is blunt:

Early (scientific) results were premature and completely misinterpreted.

Yiamouyiannis believes that

zealous experts weren't interested in the numerous studies linking fluoride with serious health risks once they had made up their minds.

Today, health and dental officials always qualify fluoride's safety with the phrase "at optimum levels," "The trouble is, the only safe or optimum amount of fluoride is none at all," says Yiamouyiannis. "While no one is going to die from drinking one glass of Toronto tap water, just as no one will die from smoking one cigarette, it is the longer-term chronic effects of fluoride ... glass after glass ... that takes its toll on human health."

Limeback, who still thinks fluoride is beneficial in toothpaste, agrees, and points out that we also get fluoride from almost everything we drink and much of what we eat.

If you are concerned about fluoride intake, one way to cut down is to buy distilled water for drinking and cooking, or buy a proper distillation unit, reverse osmosis system or a de-ionizer. Conventional filters don't remove it.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use