Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
Rejection of Fluoridation By Countries and States
Posted by HealthyMuslim, in News
Topics: Water Fluoridation Fluoridation Fluoride

  Mail To Friend    Printer Friendly Bookmark and Share

Fluoridation Rejection by Countries

Water fluoridation was stopped in the following World health Organization (WHO) Countries:

  • Federal Republic of Germany (introduced 1952, stopped 1971)
  • Sweden (introduced 1952, stopped 1971)
  • Netherlands (introduced 1953, stopped 1976)
  • Czechslovakia (introduced 1958, stopped 1988/90)
  • German Democratic Republic (introduced 1959, stopped 1990/93)
  • Union of Soviet Socialist Republics (introduced 1960, stopped 1990)
  • Finland (introduced 1959, stopped 1993)
  • Japan (introduced 1952, stopped 1972)

Fluoridation Rejection By Educated, Well-Read, Concerned Societies - Utah

Utah a national leader by not fluoridating Written by David W. Christopher M.H.
The Daily Herald, Provo, Ut.
Sunday, June 4, 2000

Utahns consistently reject fluoride because we cut through the enormous endorsements and weigh the facts. We are not behind the times, but ahead of the 60 cities that bucked the system and rejected fluoride in the 1990's. We're unique because we vote. Most cities are fluoridated by executive order. The task of unmasking this fluoride farce is monumental. Utah being the least fluoridated state is pivotal. If we can withstand the onslaught of federal, state, industrial, and of course medical pressure, Utah can send a clear message to Washington that like Europe and the majority of the world we will not be a part of the biggest hoax perpetrated on America since it's inception. One lemming bucking the crowd will be noticed by other States who then might finally call for congressional hearings ferreting out the perpetrators of this insidious practice of dumping toxic waste into our drinking water under an EPA loophole. Is fluoride toxic? Science shows fluoride is more toxic than lead (Clinical Toxicology of Commercial Products-1984) The majority of fluoride is captured into ponds from EPA required smokestack scrubbers and sold untreated to municipalities. The technical name is fluorosilicic acid, and yes it is a toxic waste that can totally dissolve any cement barriers. Is fluoride a cumulative toxin? Of course it is; that's how it's supposed to work. It attaches to the calcium in bones. That is why dentists apply it to your teeth. However, when you drink it in water it enters the blood stream and attaches to the first bones it comes in contact with. Does fluoride cause hip fractures? Yes. Hip fractures were caused inadvertently in a study designed to prove fluoride prevented osteoporosis.

In the trials elderly women were given 75 mg. per day of sodium fluoride and compared to a control group. The study ended abruptly with the horrifying discovery that fluoride caused these fractures. In light of this study another study looked at low levels of fluoride in drinking water at the optimal level of 1 ppm. Hip fractures were 27% higher in women and 41% higher in men living in Brigham City, the largest fluoridated community in Utah, compared to non-fluoridated Logan and Cedar City. These studies were verified in five additional studies including the French study (H. Jacqmin-Gadda; D. Commenges; J. F. Dartigues. Fluorine concentration in drinking water and fractures in the elderly. JAMA. 1995;273:775-776) that showed an 86% increase in hip fractures in fluoridated communities. Additionally, Toronto which has been fluoridated for 35 years has twice the hip fractures as Quebec which has never been fluoridated. Is fluoride absolutely safe? Of course not! There are more than 500 peer reviewed studies documenting adverse effects of fluoride ranging from cancer to brain damage. Tragically all of these studies will be dismissed as non conclusive by a medical system which has a predetermined mind set that fluoride is safe and effective.

For more information watch the video by Christopher Bryson on the fluoride - Deception view it here.

Another news article appearing in 2008 on citizens against fluoridation of water.

Citizens uniting against fluoride
Large-scale lawsuit seeks to ban chemical poisoning of water supply
Posted: May 13, 2008
10:22 pm Eastern

A group of private citizens in San Diego County is planning to file a large-scale lawsuit in federal court against public water districts and challenge the constitutionality of using industrial-grade hydrofluosilicic acid to fluoridate drinking water.

Jeff Green, national director of Citizens for Safe Drinking water in San Diego, told WND, "We are raising funds for a lawsuit that has been prepared for plaintiffs who are asserting their constitutional rights under the Ninth and 14th Amendments to be free of what they term 'bodily intrusions' by a water wholesaler adding an unapproved drug into their water."

Specific details about the lawsuit such as names of plaintiffs will not be revealed until the suit has officially been filed. However, Green said the filing parties are private citizens in Southern California who are seeking an injunction against public water districts to stop use of unapproved drugs in the area drinking supply.

"They are individuals who will be claiming that they shouldn't be taking an unapproved drug because they already have adverse effects happening," he said. "They already have things like kidney disease, thyroid disease and other health issues that make it important for them to have the right to control what they are exposed to."

As WND previously reported, there is growing and fierce opposition to plans to fluoridate public drinking water after shocking new studies that seriously question a practice routine among U.S. municipalities for nearly the last 50 years. Green said many citizens are usually unaware of how dangerous the chemical can actually be.

"Most people think that fluoride is what you have in your toothpaste or water, but they are unaware of the fact that Prozac is a fluoride product," Green said. "Almost all psychotropic drugs are fluoride products.

"Baycol, the drug that was pulled off the market because of muscle degeneration, is a fluoride product," he continued. "Cipro, the product they were going to use for the Anthrax vaccine, was a fluoride product. In Fen-Phen, the diet drug that got pulled of the market, the fluoride in it is what created the thickening of the heart valve. Rohypnol, the date-rape drug, is a fluoride product. If someone goes into surgery, and they use anesthesia gas, they would be using fluorothane or halothane or one of these other fluoride products."

Contrary to popular belief, Green said medical and scientific research indicates water fluoridation does not prevent tooth decay and that U.S. Water districts have asked chemical suppliers to make statements that fluoride is effective at doing so.

"There's not one chemical supplier in the entire United States that will make that statement," he said.

He hopes the lawsuit will send a message to chemical suppliers and water districts across the nation that citizens will not tolerate general poisoning of their water supply with fluoride or a variety of other contaminants.

"It's not OK for them to come out and say it's the greatest thing in the world, and then we find hazardous waste that has arsenic, lead, cadmium and mercury in it," Green said. "Where did they get the ability to add these toxins? There wasn't anything people voted for, anywhere, that said it was a reasonable implementation of public policy of fluoridation to add arsenic. The levels that are allowable would allow as much as one in every 3,000 people to have lung or bladder cancer over a lifetime of use."

Green said donations to support the lawsuit are being made to Keepers of the Well, an organization committed to promoting safe drinking water. The plaintiffs expect to file soon and assert their rights to protect themselves from poisoning.

"In essence, we're saying that these water districts may have made a determination that they want to fluoridate; that's public policy, but when it comes down to implementing it and actually pushing a substance that has never been approved by the FDA, they are actually treating people and intending to prevent disease with an unapproved drug."

And below we have a list of states that have rejected fluoridation of their water supply.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use