Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home Body
Toxicity Of Sodium Fluoride - A Poison
Posted by HealthyMuslim, in Body
Topics: Fluoride Water Fluoridation Toothpaste Fluorosis

  Mail To Friend    Printer Friendly Bookmark and Share

An informative article that brings together information that can also be found in Christopher Bryson's extremely well researched video documentary on the same subject which you can watch in full on this page here.

Got fluoride
By Paul Callahan

It was just a routine visit to a New York City dental clinic for 3 year old William Kennerly and his mother. He had a cleaning which was followed by a fluoride treatment. After the treatment was finished, William complained of dizziness and a headache. Shortly thereafter, he started sweating and vomiting. He was rushed to Brookdale Ambulatory Pediatric Unit and within two hours he went into a coma. His heart was pumped with adrenaline to revive him, but an hour later he lapsed back into a coma and died. It was determined that William's death was due to fluoride poisoning.

On January 20, 1979, the New York Times reported that the Nassau County toxicologist testified that the amount of fluoride applied to William's teeth was 3 times the amount needed to be fatal. The court found the dentist negligent and awarded damages in the amount of $750,000. As tragic as 3 year old William's death was, it is not an isolated case. Keith Kantor of McMinniville Oregon was also killed by fluoride poisoning. He swallowed a 1/2 teaspoon of the fluoride gel that was soaking his teeth during a treatment .

The incidents are too numerous to mention. Over 10,000 calls are made to poison control centers in the United States each year after children have swallowed toothpaste. In April of 1997, the U.S. Food & Drug Administration made it mandatory for toothpaste manufacturers to carry a warning label on all fluoride toothpaste to protect children. Fluoride has a very low molecular weight and each time you brush your teeth, approximately 0.5 mg. of fluoride is absorbed through the mucus lining of the mouth. According to the Department of health & Human Services, sodium fluoride is not just used to prevent dental caries. It is also a registered rodenticide and pesticide. That's right, sodium fluoride is a rat poison and roach killer.

Sodium fluoride = Rat poison

You may be asking yourself, how could our government allow this? Well, they allow cigarettes to be sold as long as they carry a health warning. We have all assumed that fluoride was a safe and effective chemical, but have you ever wondered where this cavity fighter comes from? If you are not shocked and outraged yet, you will be. Fluoride is a raw, toxic, hazardous waste byproduct from the aluminum and phosphate fertilizer industries. The U.S. Environmental Protection Agency classifies fluoride as more toxic than lead and about equal in toxicity to arsenic. EPA scientist Dr. J. William Hirzy et al, recently testified to that fact before a Senate Subcommittee on drinking water safety.

Dr. Dean Burk, Chief Chemist and Founder of the National cancer Institute has been quoted saying:

Fluoride causes more human cancer and causes it faster than any other chemical.

Dr. Phyllis Mullenix, a neurotoxicologist from Harvard Medical School, was recruited by Forsyth Dental Institute in Boston to conduct studies on the effects of fluoride on the central nervous system. In 1995, she published the results of the research. Her findings determined that fluoride accumulates in the brain and causes behavioral changes, such as hyperactivity if exposed prenatally and hypoactivity if exposed postnatally. She also concluded that fluoride may be diminishing IQ in children. Studies in New Zealand and China confirm Dr. Mullenix's findings. The study from China showed a 5 - 19 point IQ deficit in the children from fluoridated communities as opposed to the children in non-fluoridated areas. In 1998, Roger Masters, a Dartmouth College professor and Myron Coplan, a retired chemical engineer from Natick, Mass., gathered statistical evidence indicating that adolescents who lived in fluoridated areas had higher rates of violent crime. Researchers have also linked fluoride to attention deficit disorder (ADD), hypothyroidism, sudden infant death syndrome, autism and Alzheimer's disease.

The truth of the matter is that there has never been any safety testing performed on the fluorides added to the public water supplies. There have also never been any scientific studies that prove fluoride prevents tooth decay. It's actually quite the contrary. Toronto, a fluoridated city, has a higher decay rate than Vancouver, which has never fluoridated it's water. The same is true for the New York cities of Kingston and Newburgh. After 50 years of gathering statistics, non-fluoridated Kingston has a lower decay rate than fluoridated Newburgh.

Therefore, fluoridation is a complete scientific fraud.

Adding this pollutant to drinking water has absolutely nothing to due with dental health. It's basically a waste management tool for industries to dilute their toxic waste, rather than spend millions of dollars to treat and dispose of it properly. Fluoride waste is also contaminated with lead, arsenic, mercury and radium. Is it any wonder why fluoride is a main constituent of the nerve gas Sarin?

Annually, 200 - 500,000 tons of this hazardous waste is being dumped directly into our drinking water under the guise of a dental health panacea. In my opinion, the scariest part of fluoridation is that by adding this toxin into our water supplies, it is now getting into our food chain. Most foods and beverages are processed with tap water. Kellogg's fruit Loops are made in in Battle Creek, Michigan, where they fluoridate their water. Chemical analysis shows that fruit Loops have twice the amount of fluoride than the Public health Service allows in water supplies. Gerber's Berry Punch has over 3 times the recommended level of fluoride. Don't forget, fluoride is used as a pesticide and may be sprayed on the fruits that go into juices. These juices are also commonly grown in soils irrigated with fluoridated water. This may account for the high levels of fluoride in juice.

Have you ever seen someone with opaque white spots on their teeth? This is what's called dental fluorosis. Fluorosis is the first outwardly visible sign of fluoride overdose. This occurs while the teeth are forming. We only excrete 50% of the fluoride we ingest, the remainder builds up in the body and seeks your bones and connective tissue like a magnet. What is being diagnosed as arthritis is often really skeletal fluorosis.

A quote from a former fluoride advocate: Dr. Hardy Limeback, D.D.S., head of the Department of Preventive Dentistry for the University of Toronto and president of the Canadian Association for Dental Research:

Dentists have absolutely no training in toxicity. Your well intentioned dentist is simply following 50 years of misinformation on fluoride's safety and efficacy from public health and the dental association. Me too, unfortunately, we were wrong. For the past 15 years I had refused to study the toxicology information that was readily available to anyone. Poisoning our children was the furthest thing from my mind.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use