Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Recipes
How To Make Clarified Butter (Ghee) And Its Being a Cure and Remedy
Posted by HealthyMuslim, in Recipes
Topics: Ghee Clarified Butter

  Mail To Friend    Printer Friendly Bookmark and Share

Clarified butter (ghee) in the Prophetic Sunnah

Abdullaah Ibn Mas'ood (radiallaahu 'anhu) narrates that the Messenger of Allaah (sallallaahu 'alayhi wasallam) said,"Drink cow's milk, for indeed it is a remedy, its butterfat (ghee) is a cure, but beware of its meat, for indeed its meat is disease" . Related by al-Haakim, Abu Nu'aym and Ibn as-Sunnee and Imaam al-Albaanee declared it Saheeh in Saheeh al-Jaami' as-Sagheer (no. 4060).

Suhaib (radiallaahu 'anhu) narrates that the Messenger of Allaah (sallallaahu 'alayhi wasallam) said, "Drink cow's milk for indeed it is a cure, and its butterfat (ghee) is a remedy and its meat is disease". Related by Ibn as-Sunnee and Abu Nu'aym and declared Saheeh by Imaam al-Albaanee (rahimahullaah) in Saheeh al-Jaami' as-Sagheer (no.4061).

Clarified butter (ghee, from grass-fed cows) has thus been described as both a cure (shifaa) and a remedy (dawaa), and thus its health and medicinal uses are characterised in the Sunnah.

What is meant regarding the meat (beef) being "a disease", as has been explained by Muslim Scholars, is that consuming too much of it can lead to disease.

Clarified butter and health

Clarified butter is very easy to make and it is recommended that you do make it at home. One batch can last you at least a few months for cooking purposes.

You should avoid cooking (and frying) with polyunsaturated vegetable oils as they are very easily oxidizable, highly reactive and are pro-inflammatory. This means that they contribute to the development of atherosclerosis and the various factors involved in heart disease, chief of which is inflammation. Other factors include presence of many free-radicals (oxidants), and deficiencies in anti-oxidants in the body.

Ghee contains mostly short-chain fatty acids (around 65%), with only around 10% being long-chain fatty acids. Around 20% are monounsaturated fatty acids, and polyunsaturated fatty acids making up just a few percent. With this fatty acid make up, ghee has several benefits for healing and tissue repair. Short and medium chain fatty acids have been shown to aid weight loss, stimulate metabolism, aid digestion, fortify the body's immune processes, and protect against bacterial, viral, and fungal infections. It does not have the negative qualities of polyunsaturated vegetable oils that are highly oxidizable, thereby turning into free radicals, and being pro-inflammatory.

Important Note on Commercial ghee

There is a type of commercial ghee called "Dalda Ghee" or "Dalda Kyo" used mainly in Indian restaurants and Asian households (India, Pakistan etc.). This is actually vegetable ghee and is made of polyunsaturated vegetable oils, or partially hydrogenated monounsaturated fats (which are trans fats). Unfortunately this is not the same as pure ghee, and it has detrimental health effects, and shares the characteristics of pro-inflammatory polyunsaturated vegetable oils and trans fats, which when heated to high temperatures create free-radicals. These are the same factors involved in the initiation of atherosclerosis (blocked arteries) and heart disease.

Historically and natively, such populations never suffered from these conditions despite heavy consumption of ghee in their traditional diets. Coronary heart disease was relatively unknown in these populations until around 50 years ago.

Pure ghee (from milk butter fat) has a very high smoke point, and is made of stable saturated bonds, and thus is not as likely to form harmful free radicals during cooking, unlike the commercial vegetable based ghee and polyunsaturated vegetable oils.

If you purchase commercial ghee (which may be the harmful vegetable ghee), you may be subjecting yourself to the same dangers of pro-inflammatory vegetable oils. It's best just to make it yourself from good quality (organic) butter. Just a half hour of your time is required to make a few months supply.

How To Make ghee

We are going to make a 3 kilogram batch. You need quality (preferably organic) butter from grass-fed cows. This is quite a lot of ghee, at least a few months supply. It will last for a long time in the refrigerator. You may want to start with making use of just one kilogram of butter for your first attempt.

  First place it in a large enough stainless steel pot at a low temperature, enough for it to start melting.
  When it has all melted you will see a foamy like appearance at the top. This is just water and milk solids that have separated from the fat. Keep it on the heat.
  Next, we need to make all the milk solids clump together. We do this by adding two teaspoons of wholewheat flour for each kilo of butter used.
  Keep on the heat and periodically stir. You want it to bubble slightly in order to allow the water to escape from the butter. So adjust the temperature slightly to achieve this.
  You will start to see the golden coloured ghee showing through as the solids begin to fall to the bottom. At the same time, the water content is evaporating away.
  The solids will keep clumping together and falling to the bottom. It should take around half an hour for all the solids to fall to the bottom. At this point the ghee is ready to be poured out into containers. You may also wish to use a very fine sieve of some sort whilst pouring out the ghee.
  Pour it carefully into sealable containers. Leave out to cool at room temperature. The ghee should solidify as it gets cooler. You can then place in the refrigerator.

Congratulations! You now have quality home-made real, pure ghee.

How To Use ghee

You can use this for general cooking purposes and you can also just eat the ghee along with your meals, around a teaspoon per day.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use