Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Untreated Milk Cuts Childrens Allergies
Posted by HealthyMuslim, in Nutrition
Topics: Milk Homogenized Milk Pasteurized Milk Raw Milk

  Mail To Friend    Printer Friendly Bookmark and Share

An article published in August 2006 in the Daily Mail covering research published in the Journal Of allergy, asthma And Immunology on raw milk:

Untreated milk cuts children's allergies

Drinking "raw" milk could reduce children's risk of suffering allergy-related conditions such as eczema and hayfever, new research suggests.

British academics investigating why farmers' families suffer fewer allergies than others found that even occasional consumption of raw unpasteurised milk had a powerful effect.

Just a couple of glasses a week reduced a child's chances of developing eczema by almost 40 per cent and hayfever by 10 per cent

Blood tests revealed that drinking raw milk more than halves levels of histamine, a chemical pumped out by cells in response to an allergen.

It is thought the milk contains bacteria that help to prime the immune system.

The article continues:

But the findings, published in the Journal Of allergy, asthma And Immunology, are controversial because unpasteurized milk is also a source of potentially fatal food-poisoning bugs.

Raw milk was banned from sale in Scotland 20 years ago, and can be sold by farmers in England and Wales only with labels clearly warning of the risks.

The reality is that pasteurized milk is also a source of potentially fatal food-poisoning bugs. The difference is that fresh raw milk has inherent immunity built in, whereas pasteurized milk does not, so any contamination post-pasteurization will elevate the risk of food-poisoning. That's why you see extremely severe cases of food-poisoning occurring with pasteurized milk. Take for example, this case in 1987 involving almost 200,000 people with 3000 hospitalizations and 18 deaths

Here are details of other outbreaks arising from pasteurized milk. These outbreaks have been attributed to "inadequate pasteurization", or "post-pasteurization contamination". The number of cases are indicated:

  • 1966 - Florida - Shigella flexneri - 97
  • 1975 - Louisiana - Salmonella Newport - 49
  • 1976 - New York - Y. enterocolitica - 38
  • 1978 - Arizona - S. Typhimurium - 23
  • 1979 - UK - Campylobacter jejuni - 3,500
  • 1982 - Tenn., Ark., Miss. - Y. enterocolitica - 172
  • 1983 - Massachusetts - Listeria monocytogenes - 49
  • 1984 - Kentucky - S. Typhimurium - 16
  • 1985 - Illinois - S. Typhimurium - >150,000
  • 1986 - Vermont - Campylobacter jejuni - 35
  • 1992 - UK - Campylobacter jejuni - 23
  • 1992 - UK - Campylobacter sp. - 110
  • 1994 - Illinois - L. monocytogenes - 45
  • 1995 - UK - Campylobacter sp. - 12
  • 1995 - Vermont, New Hampshire - Y. enterocolitica - 10
  • 1999 - UK - E. coli O157:H7 - 114
  • 2000 - Pennsylvania, New Jersey - S. Typhimurium - 93
  • 2004 - Denmark - E. coli O157:H7 - 25
  • 2005 - Colorado - Campylobacter jejuni - 40
  • 2006 - California - Campylobacter jejuni - 1,644

As someone has rightly said: "Its too hot. It's not hot enough". What this means is that the temperature in pasteurization is too hot in that it kills off a lot of the goodness and inherent immunity in milk and its not hot enough because even at that temperature it will not kill all pathogenic bacteria. So there's the dilemma.

Other issues with pasteurized milk:

  • It destroys part of the Vitamin C content of milk,
  • It also encourages the growth of harmful bacteria (as half of its inherent immunity is destroyed).
  • It also turns lactose into beta-lactose causing intolerance in some people.
  • One of the main things is that it makes a very large part of the calcium content insoluble, which means you can't absorb it efficiently. This means that milk itself leads to rickets, bad teeth and other troubles related to calcium deficiency.
  • Pasteurization also destroys a fifth of the iodine content which can lead to constipation and makes the milk lose part of its vitality.

The article continues later:

There has been a huge increase in the number of children suffering allergies in the past 30 years. One in three is now affected by eczema, hayfever or asthma - double the level 20 years ago.

And in the past ten years, the number of people needing emergency hospital treatment for severe allergic reactions has trebled to about 6,000 a year.

One of the biggest mysteries is why children raised on farms seem to suffer less than those in towns and cities, even though they are exposed to many more allergens.

When researchers at the University of London analysed the diet and health of 4,700 primary school children in Shropshire, they found that those who lived on farms had significantly fewer symptoms of asthma, hayfever and eczema.

The study looked at whether children were breast-fed and how often they were in contact with animals or played in barns. The greatest benefits were found to come from drinking raw milk.

Great, nations for thousands of years have been having fresh unprocessed milk from pasture fed animals and enjoying its benefits. Later:

The Chartered Institute Of Environmental health is pushing for a ban on sales of unpasteurised milk in England.

Food poisoning occurs all the time, from eating salad, to meat and other foods where contamination has taken place, or due to inadequate cooking. For example between 2000 and 2007 there were on average 85,000 total cases of food poisoning per year in UK.

When you dig further you find that as antibiotics are used in farm animals, the developed antibiotic resistance leads to outbreaks of food poisoning where inadequate cooking is combined with previous use of antibiotics in affected people.

Just because outbreaks occur, it does not mean you have to ban the food, it means you've got to make hygiene standards better. Currently, in the UK raw milk is legal and the government resisted a call for its ban, implementing instead regulations for better safety standards.

But John Barron, from Beaconhill Farm in Herefordshire, says demand is growing for raw milk produced by his 40-strong herd of Jersey cows.

He sells about 50 litres a week, at £1 a litre, from his farm and through markets.

"I've got lots of customers who give it to their children and there has never been a single case of food poisoning," he says.

"I get inquiries from as far as Manchester, Birmingham and Yorkshire from people wanting to know where they can get hold of raw milk."

The secret is out. People have cottoned on. They've figured it out.

More and more people are recognizing what real milk is. Its happening all across America, in the UK and across Europe. People are realizing that sound nutrition and good eating habits do away with most illnesses.

On a closing note, if you want to get raw milk you should ensure hygiene standards are maintained in farms that provide it. Fresh milk, just like any other type of food, can undergo contamination - its not something unique to fresh milk. So hygiene is important. The added advantage with fresh unprocessed milk is that it does have inherent immunity.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use