Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Body
Overcome Sleep Problems Through Better Nutrition
Posted by SoundHealth, in Body
Topics: Sleep Insomnia

  Mail To Friend    Printer Friendly Bookmark and Share

Sleep rejuvenates both the body and the mind and is an essential way of resting, recharging and nourishing the body and brain. Without adequate sleep, even for one night, the body shows clear signs of stress, with changes in mood and concentration, a drop in levels of vital nutrients such as zinc and magnesium, and with Vitamin C used up at an alarming rate.

Many people have problems getting to sleep, staying asleep or getting enough sleep. Although insomnia can be the result of numerous factors, it is also very much affected by what you eat. Here are some natural ways to improve your sleep through better nutrition.

Stress, sugar and stimulants keep you awake

The body depends on certain hormonal patterns, body chemicals and nutrients to keep it balanced and functioning properly, for example, at night time the levels of the stress hormone cortisol should dip, calming the body and preparing it for sleep. However, if cortisol levels are out of sync (usually due to stress or a diet high in sugar and stimulants), then your ability to get to sleep or stay asleep is impaired.

Caffeine is another well known sleep disrupter. When you go to sleep, levels of the hormone melatonin- which is secreted by our pineal glands in response to darkness - increase. Research shows that coffee drinkers have half the amount of melatonin produced, and one study showed that regular coffee drinkers slept for an average of two hours less. [1]

To ensure a restful sleep, keeping blood sugar levels balanced throughout the day is important. This means eating regular meals, including some protein-rich food in your diet, avoiding refined foods, coffee, sugary foods and drinks, especially right before you go to sleep.

Balance the sleep neurotransmitters serotonin and melatonin

During the daytime, levels of the hormone adrenalin are high and keep the body stimulated, but these levels drop as you start to wind down, and serotonin and melatonin levels rise. Without enough serotonin, the body doesn't make enough melatonin, and as this chemical's main role in the brain is to regulate the sleep/wake cycle, this makes it difficult for the body to get to sleep or stay asleep.

Both of these hormones are made from the amino acid tryptophan, and to avoid a deficiency in these essential brain chemicals, ensure you have adequate amounts of B6 and tryptophan in your diet. Foods that are particularly high in typtophan are chicken, cheese, tuna, eggs, tofu, nuts, seeds and milk.

Balance your calming nutrients

A lack of the minerals calcium and magnesium can trigger or exacerbate sleep difficulties because they work together to calm the body and help relax nerves and muscles. Your magnesium levels may well be low if you are stressed or consume too much sugar. Magnesium-rich foods include seeds, nuts, green vegetables, wholegrains and seafood. Good sources of calcium are milk products, green vegetables and nuts.

Another important sleep nutrient is GABA (gamma-amino-butyric acid). This is a neurotransmitter and amino acid that acts as the brain's peacemaker, helping to turn off excess adrenalin and calm you down. Studies have associated having enough GABA in the brain with being relaxed and happy, while having too little is associated with tension, depression and insomnia [2]. Because GABA is a nutrient, it can be supplemented through diet, and it is abundant in all protein foods, but the best food sources are fish (especially mackerel) and wheat bran.

Natural sleep aids

Taking drugs for sleeping problems and anxiety is generally not advisable as medicinal sedatives are usually addictive, and taking them regularly means your tolerance increases, making higher and higher doses necessary for any effect. They also have a range of unpleasant side-effects and are strong chemicals which need to be detoxified by the body, placing a burden on your liver.

There are many natural substances which can help you sleep, but like medicinal sleeping aids, should only be used as a last resort and only used occasionally. These include the herbs valerian, hops, passion flower, St John's wort or a 'sleep formula' combining several of them. These herbs have natural sedative effects and St John's wort in particular has both serotonin and melatonin-enhancing effects, making it an effective sleep regulator. The positive effects of these herbs on aiding sleep are well substantiated in many studies, a few are given below.

References

  • [1] Ohayon MM. Interactions between sleep normative data and sociocultural characteristics in the elderly. J Psychosom Res, Vol 56(5), 2004, pp.479-86.

  • [2] Shiah IS, Yatham N. GABA functions in mood disorders: An update and critical review. Life Sciences, Vol 63(15), 1998, pp1289-1303.

  • Spinella A. The psychopharmacology of herbal medicine. MIT Press (2001).

  • Vorbach EU, et al. Treatment of insomnia: Effectiveness and tolerance of a valerian extract. Psychopharmakotherapie, Vol 3, 1996, p.109-15.

  • Stevinson C, Ernst E. Valerian for insomnia: A systematic review of randomized clinical trials. Sleep Med, Vol 1, 2000, p91-9.

  • Jacobs GD, et al. Cognitive behavior therapy and pharmacotherapy for insomnia: A randomized controlled trial and direct comparison. Arch Intern Med, Vol 164(17), 2001, p1888-96.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use