Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Coconut Oil For Beautiful Skin and Hair
Posted by SoundHealth, in Nutrition
Topics: Coconut Oil Coconut Skin Hair Anti-aging

  Mail To Friend    Printer Friendly Bookmark and Share

Coconut oil is a natural and highly beneficial oil for healthy, youthful, disease-free skin and hair. When coconut oil is applied topically or taken internally, it helps to keep the skin soft and smooth and gives hair a beautiful shine, whilst at the same time reducing the effects of aging and preventing infections from entering the skin. Unlike conventional lotions and body care products, coconut oil is a natural product and is therefore free from harsh, potentially toxic chemicals and other additives.

Protects the Skin

The chemical structure of coconut oil consists of medium-chain fatty acids, which are small molecules, making it easily absorbed into the skin and hair.

The skin consists of an outer protective layer that acts as a barrier, stopping harmful organisms from penetrating the skin. This is an oil called sebum, and is very important to skin health. Like coconut oil, it contains medium-chain fatty acids, and helps to lubricate the skin and hair, and prevent fungal and bacterial infections from entering the body.

This protective layer can be washed away by bathing or through broken skin. Applying coconut oil to the skin quickly re-establishes this natural chemical barrier, by increasing the number of antimicrobial fatty acids on the skin and therefore protecting it from infection.

anti-aging

Oils have a visible effect on all tissues of the body, especially connective tissues. These tissues are found in the skin, muscles, bones, nerves and internal organs, and support the framework for all body tissues, holding everything together. These give skin strength and elasticity. As the skin ages however, these tissues are attacked by free radicals, which cause it to sag and wrinkle.

The only way to fight this free radical damage is with antioxidants, therefore it is essential to have plenty of antioxidants in our cells and tissues to protect them. The number of antioxidants in our tissues is largely determined by the nutrients in our diet. However, coconut oil has also been found to be the ideal lotion for protecting it against damage, promoting healing and giving it a healthy, soft, youthful appearance.

Moisturizing

Pure coconut oil is an excellent natural skin moisturizer. It prevents free radical formation and the damage it causes. It helps prevent the skin from developing blemishes causes by aging and other factors. It is absorbed into the skin and keeps connective tissue strong and supple so that skin doesn't age prematurely.

This wonderful oil also makes an ideal ointment for the relief of dry, rough and flaky skin. It helps to remove the layer of dead skin cells on the outer surface of the skin, leaving it smoother, evenly textured and moisturized.

Healing and Repair

Coconut oil has been found to help stimulate healing and repair. Some of its reported health benefits for skin include helping with:

  • Inflammatory conditions like psoriasis
  • Acne
  • Fungal infections like athlete's foot
  • Sunburn
  • Healing cuts, bruises and sprains, and reducing scarring
  • Insect bites

How to Use coconut oil

To use coconut oil on the skin, massage in a small amount and reapply it often. The oil is quickly absorbed into the skin and doesn't leave a greasy film like commercial lotions and oils do. Coconut oil will gradually soften the skin with regular use, removing dead layers, and encourage the growth of new, healthier tissue.

For severely dried or cracked skin, apply a liberal amount of coconut oil to the affected area, wrap it loosely in plastic or a towel, and leave it on overnight or at least a few hours. Repeat this process until the condition improves.

Coconut oil can be used on the entire body. Massage it into the skin for best results. It can also be used on the face to improve complexion and smooth out any blemishes.

Hair Care

Coconut oil makes a great hair conditioner. It gives hair a healthy shine, is great for the scalp and helps to control dandruff. It helps to reestablish a healthy skin environment by replacing natural oils that may have been washed away.

Studies have shown that using coconut oil on the hair can help prevent combing damage and improve its overall health and appearance. One study, in particular, found that compared to sunflower and mineral oils, coconut oil was the only one that reduced protein loss for both undamaged and damaged hair when used both pre-wash and post-wash. The authors explained this difference was due to the composition of the oils. coconut oil, being rich in medium-chain triglycerides is able to penetrate inside the hair shaft, protecting it from protein loss as well as giving it body. The other two oils have a different composition and therefore have no positive impact on protein loss. Only coconut oil can protect the hair and prevent hair damage, so it is clearly the best oil to use for hair.

To use, massage warm coconut oil into the hair, leave in on overnight, and wash it out in the morning. For a more intensive treatment, soak the hair thoroughly in the oil for an hour or two, before washing.

Types of coconut oil

There are two types of coconut oil: processed and virgin. The difference between the oils depends on the amount of processing the oil undergoes and the type of coconut used. Processed oil is made from dried coconuts and has usually undergone extensive processing such as refining, bleaching and deodorizing, and is the type typically used in foods and cosmetics.

"Virgin" signifies an oil that has undergone less refining with lower temperatures and without chemicals. It is also made from fresh coconuts, and retains its naturally occurring phytochemicals (plant chemicals). Virgin coconut oil usually has a mild coconut flavor and aroma compared to more refined oils, which have less taste, smell and are colorless.

Regardless of the method of processing, however, both oils contain essentially the same amount of health-promoting medium-chain fatty acids. These fatty acids are very resistant to heat and are not harmed by processing, even at high temperatures. Therefore, all types of coconut oils are considered healthy oils.

Pure coconut oil should be a crystal clear liquid in warm conditions, and becomes a hard, white solid in cooler climates. This process does not affect the quality of the oil, and solidified coconut oil quickly becomes liquid when the container is immersed in hot water or warmed in the hands.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use