Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Body
The Link Between Vitamin Deficiencies and Dental Problems
Posted by SoundHealth, in Body
Topics: Teeth Gums Cavities Vitamin D

  Mail To Friend    Printer Friendly Bookmark and Share

A big factor for healthy teeth and gums is good nutrition, and the condition of our teeth and is usually a good indicator of how healthy or otherwise the rest of the body is. Many studies have associated poor oral hygiene with serious chronic health problems. Dental problems like cavities, tooth decay and gum disease, although not often regarded as serious diseases, are often very common. Increasing research suggests that good nutrition which prevents these conditions may also prevent from other illnesses such as cancer, diabetes, and heart disease.

Oral Hygiene and mental health

Research indicates that cavities are associated with poor mental health. For example, elderly individuals with dementia or Alzheimer's disease had an average of 7.8 teeth with fillings vs. an average of only 2.7 fillings for elderly individuals without dementia [1].

It is likely that the toxic heavy metal mercury, which makes up half of every amalgam filling, is a contributing factor. Another study found that dementia patients had higher levels of tooth decay [2], and that those with poor oral hygiene and swollen, bleeding gums were more likely to suffer memory problems linked to Alzheimer's disease and other forms of dementia. [3]. Also, the worse the condition of their gums, the higher their risks of memory blanks.

Tooth Decay and heart health

A recent review showed a clear association between cavities and heart diseases and also showed that people with poor oral health, on average, led shorter lives [4].

Cavities and diabetes

The association between cavities and diabetes is also the subject of active, ongoing research [5,6]. These studies have linked people with diabetes who also have a higher incidence of cavities, with poor overall health and oral hygiene. Further research by the same authors proposed that diets high in sugar and refined carbohydrates were the common cause of these diseases.

Vitamin Deficiencies

Dental diseases, mental diseases, heart disease, and infectious respiratory diseases, associated with being caused by common failures in metabolism, appear to more prevalent when there is a deficiency of essential nutrients, including vitamins D and C.

There is especially strong evidence for a relationship between vitamin D deficiency and cavities [7-16]. Dozens of studies have been conducted and more than 90% of the studies concluded that supplementing children with vitamin D prevents cavities.

Vitamin D is a super-nutrient essential for many bodily processes and as well as for dental health. Vitamin D deficiency is also linked to respiratory infections, cancer, Parkinson's disease, diabetes and many other ailments. Other vitamins such as Vitamin C and niacin (vitamin B3) have also proven to benefit dental health.

Improving Dental health

Good oral hygiene is an important factor in keeping teeth and gums healthy. Therefore it is important to brush your teeth regularly and thoroughly and not to eat after cleaning teeth at bedtime, as salivary flow decreases as we sleep. Saliva in the mouth is capable of rinsing acid from the teeth, therby protecting it from damage caused by acids. Also, the more time bacteria has to metabolize fermentable carbohydrates, produce acids and cause a drop in salivary pH, the greater the negative effect on your teeth.

Try to limit the amount of time your teeth are exposed to the acid produced by the bacteria in your mouth. You can do this by keeping your teeth clean, by eating less of the foods that bacteria proliferate on, and by reducing the frequency of eating.

To reduce the time teeth are exposed to these factors, it's important to:

  • avoid continuous snacking and sipping of sugary drinks,
  • allow time between meals for saliva to neutralize acids and repair the teeth,
  • decrease frequency and contact with acidic foods and drinks,
  • avoid brushing teeth immediately after consuming acidic foods, drinks, citrus fruits and juices - this allows time for the teeth to remineralisation.

References

  • [1] B Ellefsen, P Holm-Pedersen, DE Morse, M Schroll, B Andersen, G Waldemar. Caries Prevalence in Older Persons with and without dementia. Journal of the American Geriatrics Society, Volume 56, Number 1, January 2008, 59-67(9).

  • [2] J M Chalmers, K D Carter, A J Spencer. Caries incidence and increments in community-living older adults with and without dementia. Gerodontology Volume 19 Issue 2, 80 - 94.

  • [3] Stewart R, et al. Oral health and Cognitive Function in the Third National health and nutrition Examination Survey (NHANES III), Psychosomatic medicine 70:936-941 (2008).
  • [4] Meurman JH, Sanz M, Janket S. Oral infection and vascular disease. Vascular disease Prevention (2007), 4(4), 260-267.

  • [5] Diaz-Romero R, Casanova-Roman R, Beltran-Zuniga M, et al. Oral infections and Glycemic Control in Pregnant Type 2 Diabetics. Mex. Archives of Medical Research (2005), 36(1), 42-48.

  • [6] Twetman S, Johansson I, Birkhed D, Nederfors T. Caries incidence in young type 1 diabetes mellitus patients in relation to metabolic control and caries-associated risk factors. Caries Research (2002), 36(1), 31-35.

  • [7] Tisdall FF. The effect of nutrition on the primary teeth. Child Development (1937) 8(1), 102-4.

  • [8] McBeath EC. Nutrition and diet in relation to preventive dentistry. NY J. Dentistry (1938) 8; 17-21.
  • [9] McBeath EC, Zucker TF. Role of vitamin D in the control of dental caries in children. Journal of nutrition (1938) 15; 547-64.

  • [10] East BR. Nutrition and dental caries. American Journal of Public health 1938. 28; 72-6.

  • [11] Mellanby M. The role of nutrition as a factor in resistance to dental caries. British Dental Journal (1937), 62; 241-52.

  • [12] Anderson PG, Williams CHM, Halderson H, Summerfeldt C, Agnew R. Influence of vitamin D in the prevention of dental caries. Journal of the American Dental Association (1934) 21; 1349-66.

  • [13] Day CD, Sedwick HJ. Fat-soluble vitamins and dental caries in children. Journal of nutrition (1934) 8; 309-28.
  • [14] Bennett NG, et al. The influence of diet on caries in children's teeth. Special Report Series - Medical Research Council, UK (1931) No. 159, 19.

  • [15] Mellanby M, Pattison CL. The influence of a cereal-free diet rich in vitamin D and calcium on dental caries in children. British Medical Journal (1932) I 507-10.

  • [16] Brodsky RH, Schick B, Vollmer H. Prevention of dental caries by massive doses of vitamin D. American Journal of Diseases of children (1941) 62; 1183-7.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use