Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Body
Dr Russell Blaylock: Vaccination Dangers Which May Kill You or Ruin Your Life
Posted by HealthyMuslim, in Body
Topics: Vaccinations

  Mail To Friend    Printer Friendly Bookmark and Share

After 30 years of intensive research, much has been learned about how brain cells work and what goes wrong when disease arises. One of the great enigmas has been the connection between vaccinations and certain brain disorders such as:

As we learned more and more about how brain cells should work, we discovered that often normal processes, such as metabolism, could result in the accumulation of powerful chemical byproducts, called free radicals, that have the capacity to destroy these cells.

Free radicals, basically, are very reactive particles that bounce all around the cell damaging everything they touch. Most originate during the process of metabolism but can also arise from toxin exposure, irradiation and toxic metals. Because they are so destructive, cells have a network of defenses designed to neutralize them. This antioxidant network is composed of numerous components that include vitamins, minerals and special chemicals called thiols (glutathione and alpha-lipoic acid).

What Causes the free radicals

The idea that free radicals play a major role in all of the conditions listed above is now proven--the big question is why are so many free radicals being generated? In the case of autism, ADD and ADHD many came to support the idea that mercury derived from vaccines was the source of the radicals. And it was known that mercury could cause free radicals to be generated in large numbers within the brain. Evidence connecting mercury to the autism spectrum disorders, neurodegeneration and the Gulf War Syndrome is strong, but not exclusive.

Interestingly, all of these diseases also share another common event--over activation of a portion of the immune system.

It is important to appreciate that only a certain part of the immune system is overactive, because other parts, such as cellular immunity, are actually diminished. In some instances, as with the childhood disorders, the problem is congenital and in others it develops as a result of many factors such as aging, toxin exposure, poor nutrition and excessive vaccination itself. mercury can impair immune function as well.

How vaccines are Made

Basically, vaccines contain either killed viruses or bacteria, germ components, toxic extracts or live organisms that have been made less virulent--a process called attenuation. To stimulate an enhanced immune reaction against these organisms, manufacturers added powerful immune-stimulating substances such as squalene, aluminum, lipopolysacchride, etc. These are called immune adjuvants.

The process of vaccination usually required repeated injections of the vaccine over a set period of time. The combination of adjuvants plus the intended organism triggers an immune response by the body, similar to that occurring with natural infections, except for one major difference. Almost none of these diseases enter the body by injection. Most enter by way of the mucous membranes of the nose, mouth, pulmonary passages or GI tract. For example, polio is known to enter via the GI tract. The membranes lining these passages contain a different immune system than activated by direct injection. This system is called the IgA immune system.

It is the first line of defense and helps reduce the need for intense activation of the body's immune system. Often, the IgA system can completely head off an attack. The point being that injecting organisms to induce immunity is abnormal.

Because more and more reports are appearing citing vaccine failure, their manufacturers' answer is to make the vaccines more potent. They do this by making the immune adjuvants more powerful or adding more of them. The problem with this approach is that in the very young, the nutritionally deficient and the aged, over-stimulating the immune system can have an opposite effect--it can paralyze the immune system.

This is especially prevalent with nutritional deficiency.

An early attempt to vaccinate Africans met with disaster when it was discovered that many were dying following vaccination. The problem was traced to widespread Vitamin A deficiency among the tribes. Once the malnutrition was corrected, death rates fell precipitously.

Another problem we see with modern vaccines is that the immune stimulation continues over a prolonged period of time.

This is because of the immune adjuvants. They remain in the tissues, constantly stimulating immune-activating cells. With most natural infections the immune activation occurs rapidly, and once the infection is under control, it drops precipitously. This, as we shall see, is to prevent excessive damage to normal cells in the body.

What Happens to the brain With vaccination?

It seems the brain is always neglected when pharmacologists consider side effects of various drugs. The same is true for vaccinations. For a long time no one considered the effect of repeated vaccinations on the brain.

This was based on a mistaken conclusion that the brain was protected from immune activation by its special protective gateway called the blood-brain barrier. More recent studies have shown that immune cells can enter the brain directly, and more importantly, the brain's own special immune system can be activated by vaccination.

You see, the brain has a special immune system that operates through a unique type of cell called a microglia.

These tiny cells are scattered throughout the brain, lying dormant waiting to be activated. In fact, they are activated by many stimuli and are quite easy to activate. For our discussion, activation of the body's immune system by vaccination is a most important stimuli for activation of brain microglia.

Numerous studies have shown that when the body's immune system is activated, the brain's immune cells are likewise activated. This occurs by several pathways, not important to this discussion. The more powerfully the body's immune system is stimulated the more intense is the brain's reaction. Prolonged activation of the body's immune system likewise produces prolonged activation of the brain's immune system.

Therein lies the danger of our present vaccine policy.

The American Academy of Pediatrics and the American Academy of Family Practice have both endorsed a growing list of vaccines for children, even newborns, as well as yearly flu shots for both children and adults. Children are receiving as many as 22 inoculations before attending school.

What Happens When the Brain's immune system is Activated?

The brain's immune system cells, once activated, begin to move about the nervous system, secreting numerous immune chemicals (called cytokines and chemokines) and pouring out an enormous amount of free radicals in an effort to kill invading organisms. The problem is--there are no invading organisms. It has been tricked by the vaccine into believing there are.

Unlike the body's immune system, the microglia also secrete two other chemicals that are very destructive of brain cells and their connecting processes. These chemicals, glutamate and quinolinic acid, are called excitotoxins. They also dramatically increase free radical generation in the brain. Studies of patients have shown that levels of these two excitotoxins can rise to very dangerous levels in the brain following viral and bacterial infections of the brain. High quinolinic acid levels in the brain are thought to be the cause of the dementia seen with HIV infection.

The problem with our present vaccine policy is that so many vaccines are being given so close together and over such a long period that the brain's immune system is constantly activated. This has been shown experimentally in numerous studies. This means that the brain will be exposed to large amounts of the excitotoxins as well as the immune cytokines over the same period.

Studies on all of these disorders, even in autism, have shown high levels of immune cytokines and excitotoxins in the nervous system. These destructive chemicals, as well as the free radicals they generate, are diffused throughout the nervous system doing damage, a process called bystander injury. It's sort of like throwing a bomb in a crowd.

Not only will some be killed directly by the blast but those far out into the radius of the explosion will be killed by shrapnel.

Normally, the brain's immune system, like the body's, activates quickly and then promptly shuts off to minimize the bystander damage. vaccination won't let the microglia shut down. In the developing brain, this can lead to language problems, behavioral dysfunction and even dementia.

In the adult, it can lead to the Gulf War Syndrome or one of the more common neurodegenerative diseases, such as Parkinson's disease, Alzheimer's dementia or Lou Gehrig's disease (ALS).

A recent study by the world-renowned immunologist Dr. H. Hugh Fudenberg found that adults vaccinated yearly for five years in a row with the flu vaccine had a 10-fold increased risk of developing Alzheimer's disease. He attributes this to the mercury and aluminum in the vaccine. Interestingly, both of these metals have been shown to activate microglia and increase excitotoxicity in the brain.

Direct Effect of the Cytokines

Various cytokines have been used to treat cancer patients as well as other common diseases.

Studies of the effects of these cytokines on brain function reveal some very close parallels to the diseases we have been discussing. For a more in-depth study of these effects I suggest you read my article appearing in the Journal of the American Nutriceutical Association (volume 6 [fall], Number 4, 2003, pp 21-35) and in the summer issue 2004 of the Journal of the American Association of Physicians and Surgeons.

One can see:

  • Confusion
  • Language difficulties
  • Disorientation
  • Seizures
  • Memory problems
  • Somnolence
  • Low-grade fevers
  • Irritability
  • Mood alterations
  • Combativeness
  • Difficulty concentrating
  • A host of other behavioral problems
In the child, brain immune over-activation has been shown to be particularly damaging to the amygdala and other limbic structures of the brain. This can lead to unusual syndromes such as the loss of "theory of mind" and " Alice in Wonderland syndrome." It has also been shown to damage the executive functions of the frontal lobes.

In essence, what is lost is that which makes us social human beings, able to function in a complex world of ideas and interactions.

Several studies have indeed shown elevated levels of cytokines in autistic children. It is also interesting to note that these cytokines, especially interleukin-1ß and tumor necrosis factor-alpha (TNF-a) dramatically increase the damage produced by excitotoxins. So, what we see is a viscous cycle of immune activation, excitotoxin and cytokine excretion, and free radical production. The latter starts the cycle all over again.

The Role of Autoimmunity and Viral Persistence

Studies in autistic children have shown that a state of immune attack on the brain is occurring. Similar findings are seen with neurodegenerative diseases and the Gulf War Syndrome. It must be appreciated that this autoimmunity was triggered by the vaccinations and by organisms contaminating the vaccinations. Once started, the immune reaction cannot stop, thus triggering all the destructive reactions I have discussed.

Dr. Garth Nicolson has shown a direct connection between mycoplasma contamination of vaccines and the 200 percent increased incidence of ALS in Gulf War veterans. The disorder is produced by the same mechanism described above.

Another, even more common, problem is the use of live viruses in vaccines. The reason live viruses can be used is that they are weakened by passing them through a series of cultures--a process called attenuation. These attenuated, non-disease-causing viruses are then injected in hopes of stimulating the body to produce an immune attack.

The problem with this idea is two-fold.

First, we now know that in far too many cases these viruses escape the immune system and take up residence in the body--for a lifetime. A recent autopsy study of elderly individuals found that 20 percent of the brains contained live measles viruses and 45 percent of the other organs contained live measles viruses. Similar findings have been described in autistic children and the measles virus is identical genetically to the one used in the vaccine.

The second problem is that most of these viruses were found to be highly mutated. In fact, different mutations were found among viruses in various organs in the same individual.

This has been a secret kept from the public.

These attenuated viruses undergo mutation brought on by the presence of free radicals in the tissues and organs and they can mutate into virulent, disease-causing organisms. Recent studies have confirmed this frightening finding. In fact, a large percentage of Alzheimer's disease patients have live viruses in their brain as compared to normal individuals.

Once these live viruses are injected, they cannot be removed. Because the viruses stay in the body, they will be under constant free radical exposure, which can increase during times of stress, illness, exercise and with aging. It is the free radicals that cause the virus to mutate.

In essence, the viruses can exist in the brain, or any organ, either silently and slowly producing destruction of the brain or spinal cord or producing sudden disease once the virus mutates to a highly lethal form.

Source: By Russell L. Blaylock, M.D., Advanced Nutritional Concepts, LLC


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use