Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Weight Loss
Why Diets Don't Work and Tips to Lose Weight
Posted by SoundHealth, in Weight Loss
Topics: Weight Weight Loss Diet

  Mail To Friend    Printer Friendly Bookmark and Share

Trying to lose weight by restricting calorie intake and dieting is often a short term solution and the results usually don't last. The best way to lose weight and keep the weight off is to change the way you eat on a daily basis, by eating healthily, and choosing the right foods in the right amounts. This will ensure an adequate supply of antioxidants vital for combating free radicals and boosting immunity, which not only helps protect the body from diseases like cancer and diabetes, but also helps to keep the body at a healthy weight.

Metabolic Rate

Metabolism is the process of converting food into energy, or storing it as fat for future use. The rate at which this happens varies from person to person, and those with a slower metabolism tend to burn calories less efficiency, storing more as fat. This is why overweight people usually have a slower metabolism than slimmer people.

The best way to raise your metabolic rate safely is to eat a balanced diet, supplying your body with all the nutrients it needs to keep the metabolism running smoothly. Also, take regular exercise, especially anything which raises the heart rate and which helps to build and maintain muscle.

Why Calorie-Controlled Diets Often Fail

Many people follow a calorie-controlled diet to try to lose weight. They successfully lose extra pounds, only to find that in a few months time they are back to where they started, or even more overweight.

With low-calorie diets, the body sees the reduction of food as a threat and slows the metabolic rate by as much as 45 per cent.

So when you've reached your ideal weight and go back to eating normally, you end up putting the weight back on because your metabolic rate has fallen so drastically, and the body now needs less food to maintain the same weight.

Many low-calorie diets also rely on manufactured and processed low-calorie, low-fat products. These foods are often lacking in essential vitamins and minerals and have very little nutritional benefit. Not only this, but by cutting down on fats you are depriving your body of an absolutely essential food, vital for the proper absorption of other foods, and it is more likely that you will feel hungrier quicker.

Fat is a very important part of a healthy balanced diet, but it has to be the right type of fat. Good examples of healthy fats are olive oil, sesame seed oil, flaxseed oil and coconut oil. nuts, seeds and oily fish also provide beneficial essential fatty acids. The worst fats are man-made trans fats or hydrogenated fats, found in many processed foods, and should be avoided.

Blood sugar Levels

Sugar is one of the most damaging foods for the body. It affects the digestive system, causing problems such as irritable bowel syndrome, bloating, stomach cramps and weight gain. Eating too much sugar can also trigger a process caused glycation in the body. This results in stiffening tissues, and hardening joints and arteries. This is one of the main reasons for the serious health complications that are associated with diabetes.

Sugar is found in many packaged foods but, in addition, refined processed ingredients like flour are quickly broken down by the body into glucose, which is just another form of sugar.

The body is designed to run on complex carbohydrates, proteins and fats, which release energy slowly. Foods like lean meats, fish, eggs, nuts whole grains, beans, lentils, vegetables and fruit are all good choices. These foods are converted into sugar more slowly which means they provide a more consistent energy level and longer relief from hunger. This also means the body has a better chance to actually use up food rather than turning it into fat.

Vital vitamins and Minerals

The body is dependant on vitamins and minerals to be able to digest food, and break it down into sugars (or glucose) to release energy to body cells. Without these nutrients, less energy will be produced and there will be a greater tendency to lay down fat.

The transport of glucose from the blood to the cells requires vitamins B3, B6, chromium and zinc. Studies suggest that the mineral chromium enhances fat burning. Clinical evidence has found that it reduces cravings, regulates blood sugar and controls appetite. Chromium is difficult to absorb and only about 0.5 per cent of what's eaten is actually retained in the body. Good food sources of chromium are chicken, beef, whole grain bread, eggs, peppers, nuts and beans.

The further breakdown of glucose into energy requires the B vitamins, Vitamin C, plus iron and co-enzyme Q10. Co-enzyme Q10 is a compound that is naturally produced in the body. It is used to promote cell growth and protect cells from damage. The richest food sources are meat, poultry and fish, and other good sources include soya beans and nuts.

fiber

A high-fiber diet is a good way to avoid putting on weight. Fiber is an essential part of a healthy diet and is vital for the body to function properly. It slows down the rate at which glucose is absorbed from food, giving the body more time to process carbohydrates, leading to lower blood sugar levels and improved metabolism.

Fiber keeps bowels regular and prevents the digestive system from becoming sluggish. It is bulky so helps you to feel full longer.

Wheat bran is one of the least effective forms of fiber and may prevent absorption of vitamins, minerals and other nutrients. The fiber present in oats, vegetables, fruit, lentils and other pulses is much more effective and kinder to the gut.

Variety

The best way to ensure you are eating all the nutrients your body requires is by eating a varied diet. This also ensures optimum absorption of nutrients. A diet based around fresh food, with plenty of fresh vegetables and fruit, whole grain cereals, fats, and some fish, poultry and meat, will provide all the protein, fats, carbohydrates, fiber, vitamins and minerals the body needs.

Cut the Calories

One of the main reasons for being overweight is eating too much and exercising too little. If you want to lose weight, you have to eat less, and once you've lost weight, you have to keep on eating less.

Studies suggest that a lower calorie diet is associated with a longer, healthier life, with a delayed onset of disease. Researchers have also found that limiting calories slows down age-related muscle loss. They have linked their findings with the fact that restricting calories may lower the production of harmful free radicals.

So instead of dieting and restricting calorie intake to help shed those extra pounds, adopt a healthy lifestyle by changing your eating habits and becoming more active.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use