Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home General
Safety Data Sheet For Sodium Lauryl Sulfate - Its In Your Shampoos, Toothpastes and Handwashes
Posted by HealthyMuslim, in General
Topics: SLS Sodium Lauryl Sulfate

  Mail To Friend    Printer Friendly Bookmark and Share

Sodium Lauryl Sulfate, also sodium Laureth Sulfate is found in lots of cosmetics. You will find it in toothpastes, shampoos, body washes, hand washes amongst other things. This compound has been linked by some to cancer (see further below), eye disorders, rashes, hair loss, dandruff and allergies.

Its actually used as an engine degreaser and floor de-waxer (used in places like mechanics' garages).

Just download the standard Material Safety Data Sheet for sodium lauryl sulfate which establishes that at the least it is in an irritant and is toxic.

MSDS for sodium lauryl sulfate (PDF Format)
Right click and select "Save As" or "Save Target As".

Some excerpts from the sheet:

  • Hazardous in case of skin contact (irritant), of eye contact (irritant), of ingestion, of inhalation.
  • Repeated or prolonged exposure to the substance can produce target organs damage.
  • May cause damage to the following organs: skin.
  • Causes moderate eye irritation.
  • Prolonged or repeated skin contact may cause allergic dermatitis.

Here is some further information from the Green People (UK)

Sodium lauryl sulphate (SLS) is an anionic surfactant (detergent) which is included as a foaming agent (to clean and make bubbles) in a huge variety of commonly used products. These include shampoos, soaps, face and body washes, toothpaste, washing up & laundry detergents and also industrial cleansing chemicals such as engine degreasers. There are many derivatives of SLS that can be found in commercial preparations, including sodium laureth sulphate, sodium laureth-3 sulphate, and DEA or tea sodium lauryl sulphate. Although these derivatives may vary slightly in mildness, the general action and effects are essentially similar.

Growing Concern

Recently, there has been growing concern about the widespread use of these detergents and their safety has been called into question. In this report, we will review the scientific literature available and show why it may be wise to attempt to minimise your exposure to this family of foaming agents.

A major concern about SLS is the effect that it has when used in combination with other ingredients commonly found in personal care products. SLS has the potential to react with other ingredients (e.g. 2-bromo-2-nitropropane-1,3-diol, DEA, MEA, TEA) to form nitrosating agents, which in turn can form nitrosamines, which are known to be carcinogenic.

Similar names, different effects

There are several other surfactants with similar names to SLS - in particular ammonium lauryl sulphate and ammonium laureth sulphate. Although these sound very similar their molecular structure is significantly different and they do not have the same potential to irritate the skin. Also, because their molecules are larger than those of SLS, they are not able to pass through the skin and therefore cannot be absorbed into the body in the same way. Because of these differences, ammonium lauryl and laureth sulphates are considered to be milder and safer alternatives to SLS.

Effects of SLS on the Skin

  • SLS is commonly used in research laboratories as the standard ingredient (upon which all other substances are compared to) for irritating the skin.
  • A solution of just 2% SLS can increase skin thickness, cause irritation, inflammation (1) and increase other forms of immune activity in the skin (2). Some shampoos can contain more than 50% SLS.
  • SLS can cause an increase in enzyme levels in the skin, leading to redness and swelling (3). It can also lead to dryness, roughness and even flaking of the skin.

Effects of SLS in the Mouth

  • SLS can damage the delicate mucosal membranes in the mouth, causing the separation of epithelial layers from the mucosa (4).
  • Burning and severe itching of the oral mucosa following the application of SLS containing toothpaste has been reported (4).
  • The tissue damage caused by SLS increases with increasing concentration of SLS (4).
  • Switching from a toothpaste containing SLS to one without, can lead to a statistically significant decrease in the occurrence of mouth ulcers in those with recurrent aphthous ulcers (5, 6).

Effects of SLS on the Eyes

  • SLS can penetrate the cornea of the eye (even if absorbed through the skin), accumulate readily and is released slowly. These effects are greater in younger individuals (7). A single drop of SLS can remain in the body for 5 days, so if you wash a childs hair more than once a week with a SLS containing shampoo, there will be constant levels of SLS present.
  • A solution of 1.3% SLS can reduce the rate of healing in the eye (8).

Variations in response to SLS

  • There is substantial inter-individual variability in the response to SLS  not everybody will be affected to the same extent (9).
  • Younger individuals are more susceptible to the effects of SLS (10, 11).
  • The effects of SLS become more harsh with increasing temperature (12). This is important to note, as most people prefer to wash in warm water.

References

  1. ANDERSON C, SUNDBERG K, GROTH O. Animal model for assessment of skin irritancy. Contact Dermatitis 1986 Sept: 15 (3): 143-51.
  2. LINDBERG M, FARM G, SCHEYNIUS A. Differential effects of sodium lauryl sulphate and non-ionic acid on the expression of CD1a and ICAM-1 in human epidermis. Acta Derm Venereol 1991: 71 (5): 384-8.
  3. GIBSON WT, TEALL MR. Interactions of C12 surfactants with the skin: Changes in enzymes and visible and histological features of rat skin treated with sodium lauryl sulphate. Food Chem Toxicol 1983 Oct: 21 (5): 587-94.
  4. HERLOFSON BB, BARKVOLL P. Oral desquamation caused by two toothpaste detergents in an experimental model. Eur J Oral Sci 1996: 104:21-26.
  5. HERLOFSON BB, BARKVOLL P. Sodium lauryl sulphate and recurrent aphthous ulcers. preliminary study. Acta Odontol Scand 1994 Oct: 52(5):257-9.
  6. CHAHINE L, SEMPSON N, WAGONER C. The effect of sodium lauryl sulphate on recurrent aphthous ulcers: A clinical study. Compend Contin Educ Dent 1997: 18 (12): 1238-40.
  7. CLAYTON RM, GREEN K, WILSON M, ZEHIR A, JACK J, SEARLE L. The penetration of detergents into adult and infant eyes: Possible hazards of additives to ophthalmic preparations. Food Chem Toxicol 1985 Feb: 23 (2): 239-46.
  8. GREEN K, JOHNSON RE, CHAPMAN JM, NELSON E, CHEEKS L. Preservative effects on the healing rate of rabbit corneal epithelium. Lens Eye toxic Res 1989: 6 (1-2): 7-41.
  9. BASKETTER DA, GRIFFITHS HA, WANG XM, WILHELM KP, MCFADDEN J. Individual, ethnic and seasonal variability in irritant susceptibility of skin: The implication for a predictive human patch test. Contact Dermatitis 1996: 35 (4): 208-13.
  10. HERLOFSON BB, BARKVOLL P. Oral mucosal desquamation of pre- and post-menopausal women. A comparison of response to sodium lauryl sulphate in toothpastes. J Clin Periodontol 1996 Jun: 23 (6): 567-71.
  11. SCHWINDT DA, WILHELM KP, MILLER DL, MAILBACH HI. Cumulative irritation in older and younger skin: A comparison. Acta Derm Venereol 1998: 78 (4): 279-83.
  12. GOFFIN V, LETAWE C, PIERARD GE. Temperature-dependant effect of skin-cleaning products on human stratum corneum. J Toxicol 1996: 15 (2): 125-30.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use