Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home General
Health Benefits of House Plants
Posted by SoundHealth, in General
Topics: Houseplants

  Mail To Friend    Printer Friendly Bookmark and Share

House plants are used to brighten up a room and help to create a relaxing atmosphere, but they can also bring real health benefits.

Common house plants have found to purify indoor air, removing toxic air emissions like ammonia, formaldehyde, carbon monoxide, benzene, xylene and trichloroethytene. Studies have also shown that houseplants can reduce cold-related illnesses.

A NASA study found that common house plants could improve indoor air quality. They reported that houseplants were able to remove up to 87 percent of air toxins in 24 hours. The report can be viewed here.

Some of the results from the study:

"Low-light-requiring houseplants, along with activated carbon plant filters, have demonstrated the potential for improving indoor air quality by removing trace organic pollutants from the air in energy-efficient buildings...

The plant root-soil zone appears to be the most effective area for removing volatile organic chemicals. Therefore, maximizing air exposure to the plant root-soil area should be considered when placing plants in buildings for best air filtration."

B.C. Wolverton B C Interior landscape plants for indoor air pollution abatement September 15, 1989 NASA

How Plants Purify the Air

Plant leaves can absorb certain organic chemicals and destroy these chemicals by a process called "metabolic breakdown." This was proven by a group of German scientists who looked at the absorption of formaldehyde and its metabolic destruction inside a spider plant (Chlorophytumn comosum). The formaldehyde was metabolized and converted into tissue products such as organic acids, sugars and amino acids. This information is published in the Plant Physiology Journal. [Giese M Detoxification of formaldehyde by the spider plant (Chlorophytum comosum). Plant Physiology, 1994, 104: 1301-1309].

When plants take in water vapor from their leaves, they pull air down around their roots, supplying their root microbes with oxygen, as well as other substances in the room air, such as toxic chemicals, and use these as a source of food and energy.

Plants Help Control Indoor Humidity

According a study carried out at the University of Agriculture in Norway, "Indoor plants can reduce fatigue, coughs, sore throats and other cold related illnesses by more than 30%", partially by increasing humidity levels and decreasing dust. Interior plants actually stabilize the humidity in your house by releasing moisture according to the existing levels of humidity in the air. [Dr Tove Fjeld, University of Agriculture, Norway 1995]

Some Beneficial Houseplants

Below are some of the chemicals found in the modern home and the best plants for removing these chemicals, in order of effectiveness according to the NASA study.

Note: The common names are used for these plants, but as these can vary for different countries, the botanical names are also provided below.

formaldehyde

This is used in the construction of buildings in the form of urea-formaldehyde foam insulation (UFFI) and is also present in considerable quantities in wood used often in fitted or flat-pack furniture (e.g. kitchen cupboards and counters, bedroom wardrobes/closets). Other sources of formaldehyde include household cleaning products, fire retardants in soft furnishings, carpet backings.

Formaldehyde irritates the mucous membranes of the eyes, nose, throat and respiratory system and is known to exacerbate asthma and trigger attacks.

Best formaldehyde-removing plants: bamboo palm, dracaena 'Janet Craig', mother-in-law's tongue, dracaena marginata, peace lily, green spider plant, and golden pathos.

Benzene

Found in considerable amounts in tobacco smoke, commonly used as a solvent, and found in many common items such as paints, inks, oils, plastics, rubber, household cleaning products and petrol/gasoline.

Chronic exposure to even relatively low levels of benzene is associated with headaches, loss of appetite, drowsiness, nervousness, psychological disturbances and diseases of the blood system, including anemia and bone marrow diseases.

Best benzene-removing plants: gerbera daisy, pot mum, peace lily, bamboo palm, dracaena warneckei, English ivy and mother-in-law's tongue.

Trichloroethylene

A widely used industrial solvent that is often found in printing inks, paints, lacquers, varnishes and adhesives.

Trichloroethylene is a central nervous system depressant and can cause headache, dizziness, and confusion. It is also known to cause liver and kidney problems with prolonged exposure and is now known to be cancer causing.

Best trichloroethylene-removing plants: gerbera daisy, dracaena marginata, peace lily (spathiphyllum), dracaena 'Janet Craig' and bamboo palm.

Carbon Monoxide

This highly toxic gas is mainly produced from sources of combustion such as open fires, gas stoves, central heating boilers etc. All gas appliances in the home should be routinely checked for carbon monoxide leakage.

Low level exposure causes dizziness and headaches while more acute exposure can lead to death since it prevents the delivery of oxygen to the body's cells.

Best carbon monoxide-removing plants: bamboo palm, spider plant, golden pathos, dracaena 'Janet Craig'. dracaena marginata, snake plant, peace lily, chrysanthemum, English ivy and heartleaf philodendron.

Botanical Names

  • Dracaena marginata - Dragon Tree
  • Hedera helix - English Ivy
  • Chamaedorea seifritzii - Bamboo palm
  • Ficus benjamina - Ficus
  • Gerbera jamesonii - Gerbera daisy
  • Deremensis 'Janet Craig' - Dracaena 'Janet Craig'
  • Dracaena massangeana - Mass cane/Corn cane
  • Spathiphyllum 'Mauna Loa' - Peace lily
  • Chrysanthemum morifolium - Pot mum
  • Chlorophytum elatum - Green spider plant
  • Scindapsus aureus - Golden pothos
  • Dracaena deremensis 'Warneckei' - Warneckei
  • Sansevieria laurentii - Mother-in-law's tongue

The houseplants were found to be more effective at removing chemicals from the air when they were in optimal conditions for their health and growth. So remember to look after your houseplants, water them and keep them healthy, and they will keep you healthy.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use