Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Probiotics: The Key to Better Health
Posted by SoundHealth, in Nutrition
Topics: Probiotics Prebiotics Bacteria Allergies Asthma Obesity Inflammation Antibiotics Probiotic

  Mail To Friend    Printer Friendly Bookmark and Share

Growing research is finding that one of the keys to good health can be found in our guts - specifically, in the bacteria that live in the digestive tract. These bacteria are known as probiotics, and they have been associated with improving digestive health, reducing inflammation, food allergies, skin conditions, obesity and more.

This "good" bacteria not only helps to promote digestive health, but also stimulates a healthy immune system by helping the body to absorb nutrients. 80% of immune system is located in the digestive system, and the largest number of good bacteria occur in the small and large intestines. The human body is made up of an estimated 100 trillion bacterial cells from at least 500 species, not including viruses and fungi. These bacteria, or probiotics are sometimes referred to as "friendly" bacteria, whose job it is to repopulate the bowel and which are responsible for several important biological functions in the body. Probiotics:

  • Reduce the population of bad bacteria
  • Discourage pathogenic organisms from invading the digestive system
  • Help the contraction and relaxation of the muscles in the gut wall
  • Improve the consistency of bowel motions
  • Reduce inflammation
  • Reduce flatulence
  • Increase absorption of vital nutrients

prebiotics

"prebiotics" are food ingredients that stimulate the growth and/or activity of bacteria in the digestive system, in other words they serve as food for bacteria in the digestive tract. They are equally important as probiotics and are necessary to keep the supply of good bacteria alive to continue to keep the bad bacteria in check. For example, inulin, a form of indigestible starch found in many root vegetables including onions and garlic is a common prebiotic.

Health Benefits of probiotics

The body is naturally inhabited by healthy bacteria, however inadequate diet, environmental toxins, stress, antibiotics, and other factors can disrupt or even destroy good bacteria, leading to stomach illnesses, digestive problems, and diseases such as Crohn's disease or colon cancer. Probiotics help the digestive system recover by balancing out the good and bad bacteria.

Probiotics have been found to help with food allergies, calming inflammation and helping to eliminate many health problems, including asthma, which is often the result of systemic inflammation caused by food allergies, as well as some skin conditions and intestinal disorders.

A study in the journal Pediatrics in August 2009 confirmed the positive effects of probiotics in maintaining immunity and preventing disease, particularly in children. The children studied experienced a significant decrease in colds and the flu after probiotic supplementation. The study also confirmed that probiotic supplementation decreased the length and severity of illness symptoms in those that did get sick. [1]

Another significant benefit of probiotics is their ability to improve allergies. One 2005 study found that these bacteria prevented eczema in young children with an inherited tendency to develop allergies. Researchers found that 92% of babies treated had their condition improve from taking the probiotic Lactobacillus fermentum. [2]

Another 2005 study further showed that probiotics could provide relief from allergies. Young children who were suspected of having a cow's milk allergy were switched to cow's-milk-free diets (and their nursing mums to cow's-milk-free diets). All of the babies in the study improved, by an average of 65 percent and those with a food allergy improved even more if they got the probiotic Lactobacillus supplement than if they got placebo capsules. [3]

Probiotics and obesity

Another emerging topic of research examines a possible link between probiotics and obesity. Probiotics and gut microflora play a role in metabolism and one research article suggests that the balance of bacteria in the gut may help fight obesity. A study in pregnant women found that one year after giving birth, women were less likely to have the most dangerous kind of obesity if they had been given probiotics from the first trimester of pregnancy. Those who receiving daily capsules of probiotics containing Lactobacillus and Bifidobacterium, which are two of the most commonly used probiotics, were found to have the lowest levels of central obesity as well as the lowest body fat percentage. [4]

Antibiotics and probiotics

Antibiotics inhibit the growth of bacteria and are used to treat infections in the body. However they also kill off the good bacteria along with the bad stuff. One of the leading researchers into the world of probiotics, Gary Huffnagle pH.D. explains why probiotics can counter the negative effects of taking antibiotics:

"We're now finding that eliminating all the good microbes from our body results in a weaker immune system, which we believe is leading to problems such as increased incidence of chronic disease, including allergies like asthma,"

"Once you take antibiotics as your physician prescribed, follow it with some form of probiotic supplement to get the microflora in your gut back to where it should be. Your recovery and your health will be much greater."

Good Sources of probiotics

To support probiotic growth, increase the amount of cultured dairy products you eat. Foods like yoghurt, some cheeses, pickles and sauerkraut - another name for fermented cabbage, are all good sources of natural, healthy bacteria. However, not all these foods contain probiotics, look for cultured dairy products that indicate "contains live cultures" or "contains active cultures".

Many fermented dairy products such as yoghurt drinks are now available that specifically support digestive health. These typically have one or two types concentrated probiotic bacteria added to them. However, many also contain lots of sugar or artificial sweeteners too, so read the labels.

References

  • [1] Leyer GJ, Li S, Mubasher ME, Reifer C, Ouwehand AC. Probiotic Effects on cold and Influenza-Like Symptom Incidence and Duration in children. Pediatrics Vol. 124 No. 2 August 2009, pp. e172-e179.

  • [2] Weston S, Halbert AR, Richmond P, Prescott SL. Effects of probiotics on atopic dermatitis: a randomised controlled trial. Arch Dis Child. April 2005.

  • [3] Viljanen M, Savilahti E, Haahtela T, et al. Probiotics in the treatment of atopic eczema/dermatitis syndrome in infants: a double-blind placebo-controlled trial. allergy. 2005 Apr;60(4):494-500.

  • [4] Study in pregnant women suggests probiotics may help ward off obesity. The 17 th European Congress on obesity Amsterdam 69 May 2009.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use