Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home Disease
Former UK Science Chief -- Vaccines Cause Autism: 'What More Evidence is Needed?'
Posted by HealthyMuslim, in Disease
Topics: Vaccines Vaccination MMR Autism

  Mail To Friend    Printer Friendly Bookmark and Share

An article in the Huffington Post by David Kirby:

Can vaccines contribute to the onset of autism in some children? I believe that contention is not only possible, it is plausible. More research is needed.

But anyone willing to make such a statement in public opens themselves up to the wrath of science. But the problem is, there is simply no such thing as "scientific consensus" when it comes to vaccines and autism.

Any scientist who tells you that this case is closed is either stupid, lying, or shockingly unwilling to acknowledge the facts on the ground.

Of course, many scientists want this issue to "go away," as they believe it is settled. But their "belief" is counterweighted by the beliefs of other scientific and health policy authorities, who beg to disagree.

The list is significant, and growing (see below). And to it, should be added Dr. Peter Fletcher, former Chief Scientific Officer at the Department of health in the UK - (which, if I'm not mistaken, is roughly the same as our head of the FDA).

An editor at the Age of autism site, Anne Dachel, wrote to Dr. Fletcher to seek his reaction to the stories about reportedly high rates of autsim among Somali children in Minneapolis.

Here was his reply:

I have always thought since I first heard about the Somali children that this really proves the causal role of vaccines. The Amish children who have no vaccines have no autistic-like disorders and the Somali children who are newly exposed to aggressive vaccine programmes have exceptionally high levels!

What more evidence is needed?

So there you have it. A leading scientist talking about "proof" of a vaccine-autism connection -- only you won't see this statement in The New York Times or on ABC News.

This seems to be a step forward for Dr. Fletcher, who said in 2006 that the measles-mumps-rubella vaccine might be implicated in autism. According to a report in the Daily Mail:

Dr Peter Fletcher, who was Chief Scientific Officer at the Department of health, said if it is proven that the MMR jab causes autism, "the refusal by governments to evaluate the risks properly will make this one of the greatest scandals in medical history".

He added that after agreeing to be an expert witness on drug-safety trials for parents' lawyers, he had received and studied thousands of documents relating to the case which he believed the public had a right to see.

He said he has seen a "steady accumulation of evidence" from scientists worldwide that the measles, mumps and rubella jab is causing brain damage in certain children.

But he added: "There are very powerful people in positions of great authority in Britain and elsewhere who have staked their reputations and careers on the safety of MMR and they are willing to do almost anything to protect themselves.

And to you, angry scientists out there getting ready to trash me for this post -- just remember: You are not trashing me, you are trashing one of your own. And he is hardly alone.

NOTE:

During 2008, all of the following groups and individuals have advocated or considered exploring possible links between vaccines and autism:

  1. Both Presidential Candidates
  2. Director of the CDC
  3. Former head of the NIH and American Red Cross
  4. Chair of the U.S. House Science Subcommittee on Investigations
  5. Dr. Jon Poling, Pediatric Neurologist
  6. HHS vaccine Safety Working Group
  7. CDC vaccine Safety Research Agenda
  8. Medical personnel at HHS vaccine Injury Compensation Program
  9. Members of the Strategic Planning Workgroup of the IAC Committee
  10. Clinical immunization Safety Assessment Network - CISA
  11. autism researchers at Johns Hopkins University Medical School
  12. America's health insurance companies
  13. autism Speaks
  14. The United Mitochondrial disease Foundation
  15. Dr. Peter Fletcher, former Chief Scientific Officer at the UK Department of Health

[Kirby also adds the following to the list in another place]:

  1. Dr. Jon Poling, prominent neurologist and father to Hannah Poling
  2. Dr. Isaac Pessah, Professor and Chair, VM: Molecular Biosciences, Director, Center for Childrens Environmental health, University of California, Davis, and member of the Strategic Planning Workgroup for autism Spectrum Disorders of the federal Inter-Agency autism Committee (IACC).
  3. Dr. Martha Herbert, Assistant Professor, Pediatric Neurology Director, Transcend Research Program, Harvard Medical School, and member of the Strategic Planning Workgroup for autism Spectrum Disorders of the federal Inter-Agency autism Committee (IACC).
  4. Dr. Geraldine Dawson, Chief Science Officer, autism Speaks, and member of the Strategic Planning Workgroup for autism Spectrum Disorders of the federal Inter-Agency autism Committee (IACC).
  5. Dr. Jacqueline R. Weissman, Cleveland Clinic Lerner College of Medicine
  6. Dr. Richard I. Kelley, Department of Pediatrics, Johns Hopkins University Medical Center and Division of metabolism, Kennedy Krieger Institute
  7. Dr. Margaret L. Bauman, Department of Pediatrics and Learning and Developmental Disabilities Evaluation and Rehabilitation Services (LADDERS), Massachusetts General Hospital
  8. Dr. Bruce H. Cohen, Neurological Institute and Pediatrics Institute, Cleveland Clinic
  9. Dr. Katherine F. Murray, Genomic Department of Pediatrics and Learning and Developmental Disabilities Evaluation and Rehabilitation Services (LADDERS), Massachusetts General Hospital
  10. Dr. Rebecca L. Mitchell, Genomic medicine Institute, Cleveland Clinic
  11. Dr. Rebecca L. Kern, Department of Pediatrics, Johns Hopkins University Medical Center and Division of metabolism, Kennedy Krieger Institute
  12. Dr. Marvin R. Natowicz, Cleveland Clinic Lerner College of Medicine

HONORARY MEMBER

  • HHS Secretary Designee Tom Daschel, who said in November of 2002: Mercury-based vaccine preservatives actually have caused autism in children.

Source: The Huffington Post


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use