Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home General
Medicinal Treatment With Unlawful Substances Is Impermissible
Posted by HealthyMuslim, in General
Topics: Unlawful Medicine

  Mail To Friend    Printer Friendly Bookmark and Share

Shaikh ul-Islaam Ibn Taymiyyah explains the impermissibility of seeking treatment through that which is unlawful (haraam), and clarifies that the analogy between the permissibility of eating that which is unlawful out of necessity and between medicinal treatment through that which is unlawful is incorrect for the reason that eating guarantees removal of hunger (i.e. that is its very nature and it customarily and necessarily leads to that result) whereas medicinal treatments do not customarily and necessarily lead to cures, since cure from disease is not by any one specific treatment or way.

In Majmoo' ul-Fataawaa (24/272):

Shaikh ul-Islaam Ibn Taymiyyah was asked concerning the one who seeks medicinal treatment with intoxicant and swine's flesh and other than them from the unlawful things, "Is it permitted for necessity (adh-dhuroorah) or not? And is this verse, "And He has made clear to you what is unlawful for you, except that which you are compelled towards", regarding the permissibility of what has been mentioned (i.e. the unlawful substances) or not?

So he replied: medicinal treatment by that is not permissible, rather it has been established in the Saheeh, from the Prophet (sallallaahu alaihi wasallam) that he was asked about medicinal treatment with intoxicants and he said, "They are a disease", and in the Sunan, from him that he prohibited medicinal treatment that which is filthy (al-khabeeth). He said, "Indeed Allaah did not place the healing of my Ummah in that in which He made unlawful for them". And that [medicinal treatment through unlawful things] is not a necessity (adh-dhuroorah), for cure by way of them is not a matter that can be held with certainty as can satiety (removal of hunger) with the eating of meat that is forbidden. And also because cure is not designated by any one specific method, rather it can be acquired through many types of [medicinal] treatments and through other than them, as opposed to hunger, for it does not cease except with eating.

And in another place there is a further elaboration on this matter (24/268):

Those who permitted medicinal treatment with unlawful substances analogised that with the permissibility of unlawful things such as [the consumption of] the dead animal and blood for the one compelled (by hunger). This [position] is weak due to a number of angles:

  • The first of them: That the one compelled [by hunger] will achieve his aim with certainty by consuming the unlawful things, for when he eats them they will alleviate his hunger (keep him subsisting) and will end his necessity. As for the filthy things (al-khabaa'ith) then cure by them cannot be held with certainty, for how many are there that take medicinal treatment but are not cured. And for this reason, they permitted the use of the intoxicating [drink] to prevent choking because [as a fluid] it achieves the purpose and is particularized for that, as opposed to drinking it for [removing] thirst, for they have disputed regarding this, and they have said that it does not quench thirst.

  • The second: That the one compelled [by necessity of hunger] does not have any other way to end his necessity except by eating of these specific things. As for medicinal treatment, then the taking [by a person] of this filthy thing (khabeeth, i.e. intoxicant, or unlawful meat etc.) is not particularized as a means for his cure, for [medicinal] treatments are of many different types and cure can be achieved by other than [medicinal treatments] such as supplication (ad-du'aa) and incantation (ar-ruqyah), and that is the greater of the two types of medicinal treatment, to such a degree that Hippocrates remarked, "The ascription of our medicine to the medicine of the owners of temples (i.e. the religious) is like the ascription of the medicine of the infertile old women to our medicine".

    And cure (ash-shifaa) can be acquired without a [specific] chosen course (of action), rather, [it can be attained] on account of what Allaah puts into the body of innate [healing] potentials and what is similar to that.

  • The third: That eating the [meat of] dead animal for the one who is compelled [by necessity] is obligatory upon him in what is the apparent madhhab of the scholars and other than them, as has been said by Masrooq, "Whoever is compelled [by necessity] to eat the [meat of] the dead animal, and did not eat until he died, will enter the fire".

    As for medicinal treatment, then it is not obligatory in the view of the majority of the Scholars, rather, only a small faction of them held it obligatory, as has been said by some of the companions of ash-Shaafi'ee and Ahmad. In fact, the Scholars have disputed regarding which of the two is more superior, medicinal treatment, or having patience, on account of the hadeeth of Ibn 'Abbaas regarding the slave-girl who used to have epileptic seizures, and she asked the Prophet (sallallaahu alaihi wasallam) to supplicate for her. So he said, "If you like, you can have patience and Paradise is yours, and if you like, I can supplicate to Allaah to cure you", so she said, "I will have patience, but (in the course of my ailment) my [body] becomes exposed, so call upon Allaah that I do not become exposed". So he made supplication for her that she not become exposed.

    And also a portion from the Companions and Successors did not use to take medicinal treatments, rather, amongst them were those who chose illness such as Ubayy bin Ka'b and Abu Dharr, and alongside this no one showed rejection against them for abandoning medicinal treatment. Thus, when eating the flesh of the dead animal is obligatory [in the case of necessity] and [yet] medicinal treatment is not obligatory, it is [therefore] not permissible to make analogy between one and the other ...

And Shaikh Ibn Uthaimeen states (Sharh Arba'een an-Nawawiyyah p.137):

Eating [the meat of] the dead animal when hungry, when nothing else can be found, is something by which the necessity is repelled (i.e. removed).

As for medicinal treatment with what is unlawful (muharram), then it cannot be a dhuroorah (necessity) for two reasons:

Firstly: that the ill person can be relieved (of his illness) without medicinal treatment, and thus there is no necessity.

Secondly: That a person may take medicinal treatment [through what is unlawful], and not be relieved [of his illness] and thus his necessity is not repelled by way of it.

For this reason, the saying of the common people that "it is permissible to take medicinal treatment through the unlawful due to necessity", is a saying that has no authenticity to it, and the Scholars - rahimahumullaah - have textually stated that medicinal treatment through the unlawful is unlawful.

And Shaikh Ibn Uthaimeen responded to a question about the expression, "Necessities make permissible the prohibited (things)", as occurs in Fataawaa Noorun alaa ad-Darb, in the section on tafseer:

Yes, the meaning of this expression is that when a person is compelled to [consuming] something from the unlawful in a manner that will repel the necessity, then this unlawful thing becomes permissible. An example of that is a man who is in extreme hunger and he does not have anything except a dead animal, so if he ate [the meat of] the dead animal, he would not perish, and if he did not eat he would perish, so here we would say that it is lawful for him to eat from [the meat of] the dead animal because he is in a [situation] of necessity.

Similarly, if he did not have anything with him except the flesh of the pig, and he is severely hungry, and if he ate from its flesh he would remain [alive], and if he did not he would perish, then we say this is permissible because the necessities make permissible the prohibited (things).

As for what relates to [medicinal] treatment then some of the people think that this expression also applies to [medicinal] treatment and that it is permissible for a person to have [medicinal] treatment with that which is unlawful when he is compelled [by necessity] towards it as he claims. And this is incorrect because [medicinal] treatment does not repel the necessity with certainty and because sometimes he can do without it and the ill person is cured without any [medicinal] treatment. As for the first, then how many a person has had treatment with a beneficial medicine but did not benefit from it, and as for the second, how many a person has abandoned [medicinal] treatment and Allaah has cured him without any medicine.

So from the above we gather:

  • It is impermissible to use unlawful substances for purposes of medication.

  • Unlike the consumption of food and drink which remove hunger and quench thirst customarily, as a rule and with certainty, the use of unlawful substances for medicinal purposes, or even lawful medicines is not certain to bring a cure, and thus the desired end goal (cure of the illness) is not something guaranteed to occur. Thus analogizing between the two situations to argue for the permissibility of using that which is unlawful (haraam) for medicinal use is incorrect

  • cure (ash-shifaa) is not restricted just to medicinal treatments, rather cure and healing occurs with a variety of other non-medicinal means, such as through the bodies inherent healing powers placed therein by Allaah, or by way of supplication to Allaah, or by way of spiritual incantations (ar-ruqyah), and for this reason we see many people cured of their illnesses by non-medicinal means and many people not cured of their illness by medicinal means.

  • Taking medicinal treatments is not obligatory. Some scholars hold it to be permissible (mubaah), and others hold it to be mustahabb (recommended) as will be elaborated in other articles inshaa'Allaah.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use