Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home Body
Dr Russell Blaylock: The Truth Behind The Vaccine Cover-Up
Posted by HealthyMuslim, in Body
Topics: Vaccination Mercury Vaccines

  Mail To Friend    Printer Friendly Bookmark and Share

An excellent paper by Russell Blaylock, giving you an insight into how things really work behind the scenes. thimerosal is a mercury solution that is used as a preservative in vaccines, and there is established evidence of the direct link between mercury and neurological damage. However, the issue is not limited just to mercury as formaldehyde and aluminium are also use in most vaccines. Although not the subject of this article, these elements also have their own detrimental effects in combination.

You can download all the documented proof in PDF further below. From his abstract:

On June 7-8, 2000 a secret conference was held at the Simpsonwood Conference Center in Norcross, Georgia to discuss a study examining the link between increasing doses of thimerosal and neurodevelopmental disorders. The study was done using the vaccine Safety Datalink (VSD) database,an official governmental data bank collecting patient vaccination information on the children from the health maintenance organizations (HMOs) being paid to participate. Attending were 51 scientists, representatives of pharmaceutical vaccine manufacturing companies and a representative of the World health Organization; the public and the media were unlawfully excluded.

The conclusions of this meeting were quite startling, since it confirmed a dose-response link between thimerosal and neurodevelopmental disorders that held up to rigorous statistical analyses.

In their discussion, they make plain why the meeting was held in secret: the conclusions would have destroyed the public's confidence in the vaccine program, and more importantly, their faith in vaccine authorities.

When the results of this study were published three years later in the journal Pediatrics, the problem had been fixed, in that by adding another set of data from a third HMO, reorganizing the criteria for inclusion and restructuring the patient groupings, a less than statistically significant link was demonstrated. In my analysis I discuss the more outrageous statements made during the meeting and how accepted experts in the field of mercury neurotoxicity were excluded from the meeting.

And these are the opening paragraphs of the paper:

I was asked to write a paper on some of the newer mechanisms of vaccine damage to the nervous system, but in the interim I came across an incredible document that should blow the lid off the cover-up being engineered by the pharmaceutical companies in conjunction with powerful governmental agencies.

It all started when a friend of mind sent me a copy of a letter from Congressman David Weldon, M.D. to the director of the CDC, Dr Julie L. Gerberding, in which he alludes to a study by a Doctor Thomas Verstraeten, then representing the CDC, on the connection between infant exposure to thimerosal-containing vaccines and neurodevelopmental injury. In this shocking letter Congressman Weldon referrers to Dr. Verstraeten's study which looked at the data from the vaccine Safety Datalink and found a significant correlation between thimerosal exposure via vaccines and several neurodevelopmental disorders including tics, speech and language delays, and possibly to ADD.

Congressman Weldon questions the CDC director as to why, following this meeting, Dr. Verstraeten published his results, almost four years later, in the journal Pediatrics to show just the opposite, that is, that there was no correlation to any neurodevelopmental problems related to thimerosal exposure in infants. In this letter, Congressman Weldon refers to a report of the minutes of this meeting held in Georgia, which exposes some incredible statements by the "experts" making up this study group. The group's purpose was to evaluate and discuss Dr. Verstraeten's results and data and make recommendation that would eventually lead to possible alterations in the existing vaccine policy.

I contacted Congressman Weldon's legislative assistant and he kindly sent me a complete copy of this report. Now, as usual in these cases, the government did not give up this report willingly, it required a Freedom of Information Act lawsuit to pry it loose. Having read the report twice and having carefully analyzed it; I can see why they did not want any outsiders to see it.

It is a bombshell, as you shall see.

In this analysis, I will not only describe and discuss this report, but also will frequently quote their words directly and supply the exact page number so others can see for themselves.

View the above paper in its entirety in PDF Format:
Dr. Russell Blaylock - The Truth Behind the vaccine Cover Up

You can view the original study done by Thomas Verstraeten, MD here:
Neurodevelopmental and Renal Toxicity of Thimerosal-Containing Vaccines: a Two-Phased Analysis of Computerized Databases.

You can download the full Simpsonwood meeting transcript here (286 pages, 12MB):
Simsponwood meeting transcript.

You can download extracts from the above transcript (easier to read) here:
Simpsonwood meeting extracts.

You can also view extracts from the Simpsonwood meeting here:
Simpsonwood meeting extracts from aapsonline.org.

And if you are up to it, you can also read this research paper by Marcel Kinsbourne MD which is titled "Report on General Causation: thimerosal Exposure, Neuroinflammation, and the Symptoms of Regressive Autism". This was presented as an expert witnesses's testimony for a plaintiff in a court case and cites over 60 authorities.

Parents with infants and children should do comprehensive research into vaccines and make their own informed and educated decision. Specifically parents should investigate for :

  1. Absolute solid proof that the vaccine was responsible for a general decline in the disease incidence and death, this should be proven with historical record data.
  2. Evidence that the vaccine is effective, in other words solid proof that the vaccine is indeed effective and offers true immunity. Fully vaccinated individuals should NOT be getting the disease. If people who have received the full course of vaccination for a particular disease go on to get the disease, this brings the efficacy of the vaccine into question.
  3. Natural, non-invasive alternatives that will offer the same, if not better benefits. For example, high doses of Vitamin A and Vitamin C have been established to reduce both disease adverse effects and mortality from measles once contracted in infants, or to prevent the disease outright. This is established research - but you won't find vitamins being promoted because they don't make as much money as vaccines (vitamins and naturally occurring nutrients can't be patented). If you want to know more, get this book Curing the Incurable: Vitamin C, Infectious Diseases, and Toxins by Thomas A Levy.
  4. Whether the disease risk or the vaccination risk is greater. Many diseases pose little threat and have relatively mild symptoms when encountered in childhood. They also provide very strong and natural lifelong immunity when contracted in childhood. So these two matters have to be weighed out.
  5. Side effects and safety of the vaccine. This knowledge should be used to help the parent decide on what vaccination policy to decide for their children.

These affairs will be covered in more detail in separate articles.

Here is a video of a congressional hearing in which congressman, Dan Burton addresses the issue of mercury and autism:


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use