Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Disease
Study Links Fluoridated Water to Bone Cancer in Boys
Posted by HealthyMuslim, in Disease
Topics: Fluoride Fluoridated Water

  Mail To Friend    Printer Friendly Bookmark and Share

Numerous articles appeared in 2006 covering the research of Elise Bassin that demonstrates a five-fold increase in risk of bone cancer in boys under the age of 20 due to fluoridated water.

Here is a snippet:

April 6, 2006 - Boys who drink fluoridated water have an increased risk of a deadly bone cancer, a new study suggests.

Elise Bassin, DDS, completed the study in 2001 for her doctoral dissertation at Harvard, where she now is clinical instructor in oral health policy and epidemiology. The study finally was published in the May issue of cancer Causes and Control.

Bassin and colleagues' major finding: Boys who grew up in communities that added at least moderate levels of fluoride to their water got bone cancer -- osteosarcoma -- more often than boys who drank water with little or no fluoride.

The risk peaked for boys who drank more highly fluoridated water between the ages of 6 and 8 years -- a time at which children undergo a major growth spurt. By the time they were 20, these boys got bone cancer 5.46 times more often than boys with the lowest consumption. No effect was seen for girls.

Unexpected Results

In a prepared statement provided to WebMD, Bassin says she "was surprised by the results."

"Having a background in dentistry and dental public health, I was taught that fluoride at recommended levels is safe and effective for the prevention of dental [cavities]," Bassin says in the statement. "All of [our analyses] were consistent in finding an association between fluoride levels in drinking water and an increased risk of osteosarcoma for males diagnosed before age 20, but not consistently for girls."

It's not surprising that Bassin found a risk for boys but not for girls. Osteosarcoma is about 50% more common in males than in females. And boys tend to have more fluoride in their bones than girls.

This study was downplayed and misrepresented by Chester Douglass - the dissertation adviser with links to Colgate-Palmolive - and a paid consultant to the toothpaste industry. As a result, he became the subject of a joint federal and Harvard ethics investigation. Here is an article in the Washington Post about it:

Professor at Harvard Is Being Investigated
Fluoride-Cancer Link May Have Been Hidden

By Juliet Eilperin
Washington Post Staff Writer
Wednesday, July 13, 2005; Page A03

Federal investigators and Harvard University officials are probing whether a Harvard professor buried research suggesting a link between fluoridated tap water and bone cancer in adolescent boys.

The National Institute of Environmental health Sciences (NIEHS), which funded Chester Douglass's $1.3 million study, and the university are investigating why the Harvard School of Dental medicine epidemiologist told federal officials he found no significant correlation between fluoridated water and osteosarcoma, a rare form of bone cancer. Douglass, who serves as editor in chief for the industry-funded Colgate Oral Care Report, supervised research for a 2001 doctoral thesis that concluded boys exposed to fluoridated water at a young age were more likely to get the cancer.

The Environmental Working Group, an advocacy organization, urged federal officials late last month to explore whether Douglass had skewed his 2004 report to the institute to play down possible risks associated with fluoridation.

The practice of fluoridating tap water -- which more than 170 million Americans drink -- has inspired controversy for years, but the majority of federal and state officials back it as a highly effective way to prevent tooth decay. The Centers for disease Control and Prevention has ranked fluoridation as one of the top 10 health achievements of the 20th century, and numerous studies have shown that fluoridation prevents tooth decay. The National cancer Institute states on its Web site: "Many studies, in both humans and animals, have shown no association between fluoridated water and risk for cancer."

Douglass reported last year that the odds of having osteosarcoma after drinking fluoridated water was "not statistically different" from the risk after drinking non-fluoridated water. But in 2001, Douglass's doctoral student, Elise Bassin, published a thesis using his data that concluded: "Among males, exposure to fluoride at or above the target level was associated with an increased risk of developing osteosarcoma. The association was most apparent between ages 5-10, with a peak at six to eight years of age."

Bassin's thesis work is considered the most rigorous human study to date on a possible connection between fluoridation and osteosarcoma, a rare but lethal form of cancer that affects males nearly twice as often as females. Patients with the cancer live an average of three years after diagnosis. In 1990, an animal study by the National Toxicology Program found "equivocal evidence" of a link between fluoridated water and cancer in male rats. And more than a decade ago, a New Jersey Department of health survey found that young males in fluoridated communities had a higher rate of osteosarcoma than those in non-fluoridated communities.

"Fluoride safety is a major public health issue, and a Harvard professor potentially falsifying public research results has huge public health implications," said Richard Wiles, senior vice president of the Environmental Working Group. He added that Douglass's role in editing a newsletter funded by Colgate-Palmolive Co. "creates the appearance of a conflict of interest."

Douglass, who has taught at Harvard since 1978 and has edited the Colgate quarterly since 1997, referred inquires to the university's press office. Harvard Medical School spokesman John Lacey said the school "takes all allegations of misconduct seriously and has a standard system for reviewing allegations of research impropriety. The school is assembling an inquiry committee to review the questions raised concerning the reporting of this work."

Douglass has not edited for the newsletter articles on the possible connection between fluoridation and cancer and has not testified publicly on the issue, Lacey added.

The institute issued a statement similar to Harvard's, saying the NIEHS "takes allegations of misconduct very seriously" and is reviewing the matter.

Bassin could not be reached.

Some public health experts, including Richard Clapp, an expert in the environmental causes of cancer at Boston University's School of Public health, think Bassin's study should prompt additional research. Researchers suspect a possible connection because half of ingested fluoride is deposited in bones, and fluoride stimulates growth in the end of bones, where osteosarcoma occurs. The Environmental Protection Agency has commissioned a National Academy of Sciences study to examine the safety of fluoridation. A report is due next year.

"It's important, and it needs to be followed up," Clapp said of Bassin's work. "There's a legitimate biological rationale for focusing on young boys."


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use