Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home General
The Qu'ran is a Cure
Posted by HealthMeansWealth, in General
Topics: Quran Healing Cure

  Mail To Friend    Printer Friendly Bookmark and Share

The Qur'an is a cure

Allaah said that his Prophet Ibrahim (peace be upon him) said,

And He feeds me and quenches my thirst and when I fall sick then He (Allaah) cures me. [Soorah Shu'araa: 80].

Some scholars of Tafseer explain that there is a relation between what we eat and drink and falling sick since most people fall ill because of their diet. This could be a reason why Allaah mentioned that Ibrahim (peace be upon him) recognized that Allaah is the One who provides sustenance for us but that sickness is due to our own self and this is why sickness is mentioned after food and drink in this verse.

And We sent down of the Qur'an that which is a healing and a mercy to those who believe. [Soorah Israa: 82].

A healing to 'those who believe' showing the importance of rectifying our belief and actions such that we are true believers if we want the Qur'an to benefit us.

Ayub (peace be upon him) called upon his Lord,

And remember Ayub when he cried to his Lord: Verily, distress has seized me, and You are the Most Merciful of all those who show mercy. [Soorah al-Anbiyaa: 83].

This was when he was inflicted with harm. And the reply came from his Lord:

We answered him and removed the distress that was on him... [Soorah al-Anbiyaa: 84].

O mankind! There has come to you a good advice from your Lord (Qur'an) enjoining all that is good and forbidding all that is evil, and a healing for that which is in your breasts, a guidance and a mercy for the believers. [Soorah Yunus: 57].

This shows us that the Qur'an has four benefits:

  • A good advice.
  • cure for our hearts from all diseases.
  • Guidance.
  • Mercy for mankind.

Say: it (the Qur'an) is a healing for those who believe, a guide and healing... [Soorah Fusilaat: 44].

The Messenger (sallallaahu alayhi wasallam) said, "There is no-one who is afflicted by distress and grief, and says: 'Allaahumma inni 'abduka ibn 'abdika ibn amatika naasiyati bi yadika, maada fi hukmika, 'adlun fiy qadaa'ika. As'aluka bi kulli ismin huwa laka sammayta bihi nafsaka aw anzaltahu fi kitaabika aw 'allamtahu ahadan min khalqika aw ista'tharta bihi fi 'ilm il-ghayb 'indaka an taj'al al-Qur'aana rabee' qalbi wa noor sadri wa jalaa' huzni wa dhihaab hammi (O Allaah, I am Your slave, son of Your male and female slaves, my forelock is in Your hand, Your command over me is forever executed and Your decree over me is just. I ask You by every name belonging to You which You have named Yourself with, or revealed in Your Book, or You taught to any of Your creation, or You have preserved in the knowledge of the Unseen with You, that You make the Qur'an the harvest of my heart and the light of my chest, and a departure for my sorrow and a release for my anxiety),' but Allaah will take away his distress and grief, and replace it with joy." He was asked: "O Messenger of Allaah, should we learn this?" He said: "Of course; everyone who hears it should learn it."

And Allaah said:

And if Allaah tests you with affliction, there is none who can remove it but He. [Soorah Yunus: 107].

And also:

And He will give you victory over them and heal the breasts of a believing people. [Soorah Tawbah: 14].

When You sleep Read Ayatul Kursi

Abu Hurairah reported that the Messenger (Sallallaahu Álayhi Wasallam) said, "When you are about to sleep recite Ayatul Kursi till the end of the Verse for there will remain for you a protection from Allaah and no devil will draw to you until morning." [Saheeh al-Bukhaaree].

The Last Two Verses Of Soorah Al-Baqara

The Messenger (Sallallaahu Álayhi Wasallam) also said, "whoever recites the last two Verses of Soorah al-Baqara at night, those two Verses shall be sufficient for him." [Saheeh al-Bukhaarree and Saheeh Muslim].

The Last Three Chapters Of The Qur'an

When retiring to his bed every night, the Messenger (sallallaahu alayhi wasallam) would hold his palms together, blow into them, recite the last three chapters of the Qur'an and then wipe his entire body as much as possible with his hands, beginning with the head and face and then all parts of the body. He would do this three times. [Saheeh al-Bukhaaree and Muslim].

Soorah al-Falaq and Soorah An-Naas

Aisha (may Allaah be pleased with her) said, "When someone fell ill from the Prophet's family he did 'nafath' on them (to blow three times over them reciting the two chapters of seeking refuge -Soorah al-Falaq and Soorah An-Naas). When he himself fell ill, the illness which lead to his death& I would (similarly) do 'nafath' on him and would wipe him with his own hands for it was more blessed that my hands." [Saheeh Muslim].

We Turn To Allaah In Distress

Allaah said regarding Dhun Nun when called upon Allaah to remove his distress and Allaah replied,

We answered his call and delivered him from the distress. And thus We do deliver the believers. [Soorah anbiyaa: 87-88].

We Turn To Allaah When People Try To Harm Us

And you will remember what I am telling you, and I leave my affair with Allaah, verily Allaah is ever watchful over His slaves. [Soorah Ghaafir: 44].

Then Allaah said:

So Allaah saved him from the evils that they plotted (against him), while an evil torment encompassed Fir'aun's people. [Soorah Ghaafir: 45].

Soorah Faatihah Is A cure

It is also a cure when read over the sick. They are cured by the permission of Allaah because the Messenger (sallallaahu alayhi wasallam) said to Abu Sa'eed al-Khudri (may Allaah be pleased with him) after he (Abu Sa'eed al-Khudri) read it over a person who had been bitten by a scorpion and was cured, "How did you come to know that it is a cure?" [Agreed upon, Saheeh al-Bukhaaree (2276) with the additional wording, "You have done the right thing."].

Source: HealthMeansWealth


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use