Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
Untreated Raw Milk Gains in Popularity and Demand
Posted by HealthyMuslim, in News
Topics: Raw Milk Milk

  Mail To Friend    Printer Friendly Bookmark and Share

The following article appeared in the Telegraph, dated 18th January 2008. It highlights a growing realisation amongst consumers of the benefits and superiority of raw untreated milk over milk produced by the dairy industry. It is one of scores of news articles that have appeared over the last year or so on this issue.

One thing to note when you read about raw milk (as again there is a lot of propaganda and scaremongering against it) is that there are two types of raw milk. Firstly, The raw milk that is produced from cows that are only fed on pasture in the open. And secondly the raw milk from cows that are fed grains, are injected with growth hormones (to produce more milk) and are kept in mass herds on solid ground (not grass) to produce milk.

Obviously the two types of raw milk are certainly not the same.

Here is the text of the Telegraph article:

Lucinda Labes joins the growing queue of urbanites who are mad about untreated milk

I realised something was up when the queues in my local farmers' market - in London's Queen's Park - started bulking up beside the milk van. There the milk drinkers stood, whatever the weather, sending emails on their BlackBerrys or humming songs to their toddlers as they awaited their turn. Then they'd emerge, ostentatiously clutching cartons of butter-yellow milk, with pots of golden cream nestled on their Bugaboos.

Was I imagining it, or did they want me to see the prominent warning labels?

"This milk has not been heat treated and may therefore contain organisms harmful to health." An elixir of health or a carrier of disease?

The jury is out in Britain, where more and more people are drinking raw milk.

At farmers' markets across the country, demand is on the up. Despite government warnings that unpasteurised milk is one of the surest ways to pick up salmonella, campylobacter and E.coli, the 150 or so small dairy farmers who supply the markets are enjoying a big growth in sales.

In the past year, for example, Dave Paul, a third-generation farmer with a Guernsey herd at Olive Farm in Somerset, has seen his sales of raw milk and cream climb 30 per cent at London's farmers' markets.

And other dairies, which formerly brought only cheese to urban markets, are now compelled by popular demand to bring milk, too.

Who are these dare-devil milk drinkers? And why are they so keen?

"It just tastes good," says Lucia, who buys her milk at Notting Hill Farmers' Market in west London every Saturday.

A couple of lads in tracksuits and trainers are stashing 12 litres into a backpack. They come regularly from north London for their milk. "It's better for you," they say. "It's never made us ill."

People from across London come to Notting Hill to stock up.

They are affluent, hip cognoscenti who would sooner eat cat litter than non-organic food, and who want to know a chicken by name before they will eat its eggs.

But aren't they dicing with disease? The Government would have us think so.

"The risk of food poisoning from unpasteurised milk is very real," says a spokeswoman from the Food Standards Agency (FSA). "We particularly wouldn't recommend it for vulnerable people - the sick, infants and the elderly."

One of the main reasons raw milk was banned in the first place was because 65,000 people caught TB from it. Although the likelihood of this happening today is negligible, bovine TB is increasing.

At present, dairy farmers in Britain are only allowed to sell unpasteurised milk directly to the consumer, either from a milk float, the farm gate or a farmers' market.

You won't find it in Sainsbury's.

Elsewhere, the legislation is more draconian. In Scotland, raw milk has been banned since 1983 after a scary outbreak of milk-related illnesses. In America, you virtually have to own a cow to get your hands on the stuff.

Yet before the 1950s, raw milk was the norm on every breakfast table in the country. The Queen is still said to be a fan of raw milk from her Windsor Castle herd.

Proponents see unpasteurised milk as a panacea. They point out that pasteurisation - whereby milk is heated to 72C for 15 seconds and then rapidly cooled - destroys all enzymes, the very things that make it digestible to humans.

Raw milk is also higher in vitamins, is full of healthy bacteria such as acidophilus and seems to have a protective effect against asthma and allergies in children.

So why the laws?

As farmer Chris Hall of St Levan, West Cornwall, says: "In Britain you are allowed to drink yourself silly and smoke carcinogenic fags, but you can't drink raw milk. It doesn't make sense."

Thomas Cowan, a doctor from San Francisco, sees it as a big-versus-small business issue. "In order to produce raw milk, you need healthy cows, which precludes big business. You can't raise a healthy cow on anything but pasture. The giant dairies keep cows on concrete and feed them grains, soya and sometimes even meat; they turn them into factory animals. And then the cows get sick. You couldn't drink raw milk from those herds."

In Britain, the small dairies are much cleaner now than they were when pasteurisation came in. In addition, farmers who want to sell raw milk must pay for frequent tests.

"The fashion not so long ago was for cheap food," says Tim Jones of Lincolnshire Poacher, whose raw milk and cream sell like hot cakes. "Now people want quality. They want to feel connected to the land."

For me, the real test is in the taste. It is with trepidation that I try my first glass of cold raw milk. It's delicious: as silky as ice cream and as sweet as the smell of clover-strewn meadows. I'm not sure I'd feed it to my toddler, but I'll be in that queue again next weekend.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use