Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
More Americans Getting Multiple Chronic Illnesses
Posted by HealthyMuslim, in News
Topics: Chronic Illness

  Mail To Friend    Printer Friendly Bookmark and Share

Before we quote this news report that's making the rounds all over the web a few remarks are in order.

All of these chronic illnesses are due to abuses in the diet. These abuses include:

  • Eating food that is nutrition-less (or thereabouts)
  • Overeating, which can be put in a slightly different way: greed and gluttony!
  • The presence of decayed, putrified matter in the intestines and colon (due to overeating, and eating processed, refined foods, and eating food on top of previously undigested food, and not having enough fiber in the diet)
  • Intake of excitotoxins in the body such as aspartame, monosodium glutamate (MSG), mercury, aluminium and others, leading to neurological damage and hormonal disruption
  • Widespread consumption of refined and hydrolysed polyunsaturated vegetable oils (that undergo oxidation)
  • Widespread use of margarine
  • Inferior quality, "distillery slop" milk from CAFOs (concentrated animal feeding operations) made from sick cows, fed on distillery grains (grains previously used to ferment alcohol) pumped up with antibiotics, and injected with synthetic bovine growth hormone (thanks Monsanto!)
  • Excessive acidity in the body due to overconsumption of meat and processed foods
  • Depleting your body's "enzyme potential" by only having cooked foods in your diet without raw and fresh foods that retain their inherent enzymatic activity and which essentially predigest or self-digest (thereby preventing your body from using its own limited "enzyme potential", a process that contributes to ageing)

The end result? An abused, battered and bruised pancreas (leading to diabetes), obesity, liver disease, kidney failure, heart disease, nervous disorders and many other complications. Have you noticed how its all of the major organs being affected? The gut, the liver and the kidneys (these are you bodies first three lines of immune defense), the pancreas and the heart.

Whilst genetic factors may predispose you to certain conditions and diseases, it is your lifestyle and diet that will mostly determine the development and outcome of disease, if any, and its progression (after Allaah's decree of course).

Here is the news article:

More Americans getting multiple chronic illnesses

Will Dunham, Reuters
Published: Tuesday, January 06, 2009

WASHINGTON (Reuters) - More Americans are burdened by chronic illnesses such as diabetes and high blood pressure, often having more than three at a time, and this has helped fuel a big rise in out-of-pocket medical expenses, a study released on Tuesday showed.

With prescription drugs playing a key role, average annual out-of-pocket medical costs -- those not covered by health insurance -- rose from $427 per American in 1996 to $741 in 2005, researchers wrote in the journal health Affairs.

Adjusting for inflation, that translated to 39 percent more in out-of-pocket spending per person over that time, according to Kathryn Paez of Maryland-based health research organization Social & Scientific Systems Inc. and colleagues.

The figures were much higher among the elderly. For example, a person insured through the Medicare program for those 65 and older who had three or more chronic conditions paid an average of $2,588 of out-of-pocket medical expenses.

A separate report published in the journal on Tuesday showed U.S. Health care spending rose to $2.2 trillion in 2007, or $7,421 per person.

Based on government survey data, 44 percent of Americans in 2005 had at least one chronic medical condition, which could include diabetes, high blood pressure, high cholesterol levels, cancer, arthritis, heart failure and others. That compares to 41 percent in 1996.

The study did not look directly at the causes of the increases, but there appear to be several factors.

The rise in Americans with multiple chronic illnesses comes as obesity and sedentary lifestyles have grown more common. Obesity contributes to many chronic ailments including diabetes. U.S. Health officials say the rate of new cases of diabetes soared by about 90 percent in the past decade.

TRIPLE BURDEN

But the percentage of Americans with three or more chronic illnesses rose even more sharply.

It jumped from 13 percent in 1996 to 22 percent in 2005 for ages 45 to 64, to 45 percent for ages 65 to 79, and rose from 38 percent to 54 percent for those 80 and older. Among all ages, it went from 7 percent in 1996 to 13 percent in 2005.

"The burden of chronic conditions is becoming heavier. People who already have chronic conditions no longer just have one. Now they might have three," Paez said in a telephone interview.

Chronic disease accounts for three-fourths of the more than $2 trillion spent on health care yearly in the United States.

The chronic disease increase was seen not just among the very oldest age groups but also in middle age and early old age -- regardless of sex, race, ethnicity and income level.

President-elect Barack Obama takes office on January 20 with plans to try to tackle the rising costs of the U.S. Health care system, the world's most expensive. This study suggests that growing amounts of chronic illness may complicate his efforts.

The increase in out-of-pocket medical expenses reflects not only more chronic illness, but likely other factors as well, including worrisome levels of people with no medical insurance as well as reduced coverage from some employers, Paez said.

The higher costs may make it harder for some people to pay for needed medications -- and they may not stay on them or skip doses, worsening their medical problems, Paez added.

The findings were based on nationally representative surveys of about 32,000 people in 2005 and 22,000 people in 1996.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use