Thursday, 17 May 2012    HomeAbout UsContact Us    









End the War on Fat: It Could Be Making Us Sicker
This is just one of many articles we have published previously on this issue (see related articles at bottom), indicating the wide disconnect between genuine scientific findings and actual practice, and that actual practice can sometimes be outdated ... Read more »


Chia Seeds: An Excellent Source of Omega-3 Fats and More
Chia seeds are tiny seeds which are packed with essential fatty acids, protein, fiber and many health-protective antioxidants. In fact, weight for weight, these super-seeds provide twice the protein of any other seed or grain, five times the calcium ... Read more »

Some Amazing Facts About Sweet Potatoes
The sweet potato is not actually a potato, or a yam. It is a nutritionally superior and versatile tuber that has a unique and distinctively sweet flavor. Here are some of the benefits of this delicious vegetable: High Nutritional Value Sweet ... Read more »

Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
People who eat baked or broiled fish on a weekly basis are thought to be improving their brain health and reducing their risk of developing mild cognitive impairment (MCI) and Alzheimer's disease, according to a new study. "This is the first study ... Read more »

Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
The large thistle-like plant is native to the regions of southern Europe, North Africa, and the Canary Islands. It is said that in about 800 CE, two groups of Moors were responsible for cultivation of the artichoke in Sicily and Spain. The word apparently ... Read more »

Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
The large thistle-like plant is native to the regions of southern Europe, North Africa, and the Canary Islands. It is said that in about 800 CE, two groups of Moors were responsible for cultivation of the artichoke in Sicily and Spain. The word apparently ... Read more »

Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The large thistle-like plant is native to the regions of southern Europe, North Africa, and the Canary Islands. It is said that in about 800 CE, two groups of Moors were responsible for cultivation of the artichoke in Sicily and Spain. The word apparently ... Read more »

The Mineral Selenium and Its Anti-Tumor Properties
Combs GF Jr, Gray WP. Chemopreventive agents: selenium. Pharmacol Ther. 1998 Sep;79(3):179-92. The element selenium (Se) was recognized only 40 years ago as being essential in the nutrition of animals and humans. It is recognized as being an essential ... Read more »

Imaam Al-Shaafi'ee on the Importance of Learning Medicine
Imaam al-Dhahabi wrote in al-Tibb al-Nabawi (Dar Ihyaa al-Uloom, Beirut, pp. 228-229): Chapter: Regarding the Encouragement of Teaching Medicine His (alayhis salaatu was-salaam's) saying, "Allaah did not send down a disease except that it has a ... Read more »

What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut
Probiotics and prebiotics are increasing becoming popular as a health food, but what are they, what is the difference between them and why should we take them? Growing research is finding that one of the keys to good health can be found in our guts ... Read more »

Fiber and Whole Grains 'Reduce Bowel Cancer Risk'
Eating more cereals and whole grains could reduce the risk of developing colorectal cancer, a British Medical Journal study says. Researchers from Imperial College London found that for every 10g a day increase in fiber intake, there was a 10% drop ... Read more »

Ginger Root Associated with Preventing Colon Cancer, Study
Ginger supplements reduced markers of colon inflammation in a select group of patients, suggesting that this supplement has potential as a colon cancer prevention agent, according to a study published in Cancer Prevention Research, a journal of the American ... Read more »

Boost Your Immune System For The Winter
The cold days of the winter months in particular, see a rise in respiratory tracts infections such as colds and flu. So as winter approaches, it's worth taking steps to boost your immunity. If you are fit and your immune system is healthy, your body ... Read more »

Vitamin K Is Essential for Blood Clotting, Healing and Bone Health
This little known, but important nutrient has many important functions in the body. Vitamin K is essential for the production of blood clotting proteins, it helps wounds to heal properly, and plays important roles in bone metabolism and heart health. ... Read more »

Apples and Pears Associated With Reducing Stroke Risk
A Dutch study has concluded that that eating a lot of fruits and vegetables with white flesh, such as apples and pears, is linked to protecting against stroke. While previous studies have linked high consumption of fruits and vegetables with lower ... Read more »

Health Benefits of Broccoli Require the Whole Food, Not Supplements
New research has found that a key cancer-fighting chemical in broccoli and cabbage cannot be easily absorbed in supplement form. To obtain some important health benefits associated with eating broccoli or other cruciferous vegetables, you need to ... Read more »

Delicious Raw Date and Nut Bites
These raw food bites make a wonderful snack and a healthy natural alternative to processed chocolate or other refined sugar-filled treats. Not only are they easy to make, they are also cheaper than similar raw organic bars available to buy. The main ... Read more »

Omega-3 Fish Oils Produce Healthy Babies When Taken During Pregnancy, Study
A study published online in the journal Pediatrics suggests that consuming omega-3 fatty acids during pregnancy helps to protect babies against illness during early infancy. The brain is made from omega-3 fats, so these fats are crucial for development ... Read more »

10 Foods to Eat Regularly For Better Health That Are Widely Available
Some foods are better than others for providing a superior source of antioxidants and essential nutrients. These "superfoods" are whole foods that pack a lot of punch for their weight as far as nutrition goes. Here are ten superfoods that are readily ... Read more »

Fructose Found To Be More Harmful Than Glucose
The sugar fructose is already well known to be highly detrimental to health in large doses and has been linked with contributing to ills including obesity, type-2 diabetes and an increased risk of heart disease. Further evidence again finds that weight ... Read more »

More Evidence Links High Vitamin D Levels With Lower Risk of Infection
The super-nutrient vitamin D, also known as the sunshine vitamin, is a key nutrient in the fight against disease and for better health. In recent years, some scientists have suggested that the upsurge in infections seen in the winter is linked to lower ... Read more »

Almonds: The Healthy Snack Linked to Weight Loss
The results of a study have found that supplementation with almonds, in contrast to complex carbohydrates, is associated with greater reductions in weight and BMI, waist circumference, fat mass, total body water and systolic blood pressure. Although ... Read more »

Cancer Fighting 'Super Broccoli' on Sale in UK
An article published in the : A heart disease and cancer-fighting "superbroccoli" developed by British scientists goes on sale in the UK today. The vegetable looks the same as normal broccoli but contains boosted levels of glucoraphanin, which ... Read more »

10 Reasons to Avoid Refined Sugar
Sugar comes in many forms. Fructose and glucose are monosaccharides, known as simple sugars. Glucose is the primary sugar in the blood, and fructose is the primary sugar in fruit and high fructose corn syrup. The simple sugars can combine to form more ... Read more »

Zinc Supplements Shorten Common Cold Duration, Research Suggests
Zinc lozenges are associated with shortening the duration of common cold episodes by up to 40%, according to research. The evidence emerged from the combined results of 13 trials which tested the ability of zinc lozenges, which dissolve in the mouth ... Read more »

Our Incredible Regenerating Body
Allah, the Exalted says in the Qur'an: وَفِي أَنفُسِكُمْ أَفَلَا تُبْصِرُونَ And ... Read more »

Pomegranate Juice Reverses Heart Disease (Clogged Arteries)
Pomegranate juice consumption for 3 years by patients with carotid artery stenosis reduces common carotid intima-media thickness, blood pressure and LDL oxidation. Clin Nutr. 2004 Jun;23(3):423-33 Dietary supplementation with polyphenolic antioxidants ... Read more »

Do You Have a Common Nutritional Deficiency?
More and more studies are showing that chronic diseases are linked with nutritional deficiencies. In an ideal world, we would get everything that we need from our food. However, due to factors such as the degeneration of our soil quality and the rise ... Read more »

Preserve Eye Health Through Diet
Healthy eyes look clear, vibrant and give a more youthful appearance that those that look dull and tired. Our eyes in particular, are more susceptible to damage from lifestyle and environmental factors than any other organ. The good news is that high ... Read more »

Tips For Youthful, Healthy Skin
The foods we eat directly impact on our bodies - both inside and out. The skin is the largest organ and provides a good indication of what is going on inside your body. Good nutrition and diet play a key role for healthy skin, and by correcting nutritional ... Read more »






Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use