Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Mind
Happiness Boosts Health and Longevity
Posted by SoundHealth, in Mind
Topics: Health Longevity Happiness

  Mail To Friend    Printer Friendly Bookmark and Share

Many research studies have proven that positive thinking and being happy can help you to lower the risk of disease and live longer.

Scientific research shows that happiness has real health implications, providing proof that happiness has a physiological effect on conditions such as diabetes and heart disease. Findings suggest that those who are happier heal more quickly, have stronger immune systems and, on average, live longer.

Happiness Protects the heart

A team from University College London found that happiness leads to lower levels of stress-inducing chemicals. [1] They found that when happier people experienced stress, they had low levels of a chemical that is associated with increasing the risk of heart disease.

It was found that those who were happy less often had higher levels of a bloodstream chemical called plasma fibrinogen, which shows if there is inflammation present in the body, an indicator of how great a risk a person has of developing heart disease in the future.

They also found that levels of cortisol - a stress hormone - were 32 per cent lower in people who reported more happy moments. Cortisol has been related to abdominal obesity, type-2 diabetes, high blood pressure and autoimmune disorders.

The researchers also discovered happy people have had lower levels of fibrinogen when they were stressed.

The lead author said:

"It has been suspected for the last few years that happier people may be healthier both mentally and physically than less happy people.

"What this study shows is that there are plausible biological pathways linking happiness with health."

A 2009 study from the University of Pittsburgh involving nearly 100,000 women, found that those with an optimistic outlook had a 90 per cent lower risk of suffering heart disease and were 14 per cent less likely to die over the eight years the study took place than their pessimistic peers. [2]

Another 2009 study found a link between happiness and faster recovery from surface wounds. [3] Sixty participants who underwent a procedure that created a wound on the skin, and those with a positive attitude had a faster recovery time.

Happiness and colds

Research in 2003 found that people who are energetic, happy and relaxed are less likely to catch colds. [4]

The researchers found people who had a positive emotional attitude were not infected as often and experienced fewer symptoms than people with a negative emotional style.

After assessing 334 healthy volunteers, each volunteer got a squirt in the nose of a rhinovirus - the germ that causes colds.

The researchers kept the subjects under observation for five days to see whether or not they became infected and how they manifested symptoms.

Tests showed that positive people were no less likely to be infected with the virus. However, infection seemed to produce fewer signs and symptoms of illness.

The lead researcher said: "We found that experiencing positive emotions was associated with greater resistance to developing a common cold.

"But a negative emotional style had no effect on whether or not people got sick."

The author believes the findings suggest that a positive outlook may impact on how effective the immune system is at fighting disease.

He said that a more upbeat attitude may also help to reduce the risk of other infectious diseases, explaining:

"The symptoms of a cold are caused by the release of chemicals such as cytokines, histamines and bradykinins.

"The release of these chemicals is to some extent under the control of hormones that are produced when we experience various emotions.

"We think that the levels of these hormones in happy people may partly protect them from developing symptoms of cold when infected by a cold virus."

Happiness and longevity

A study published by a Dutch professor last year found that after reviewing 30 studies carried out worldwide over periods ranging from one to 60 years, that the effects of happiness on longevity were "comparable to that of smoking or not", and said that happiness could lengthen life by between 7.5 and 10 years. [5]

He found that whilst feeling cheerful did not appear to prolong the lives of those already suffering from disease, on the contrary, among healthy populations, happiness appeared to protect against falling ill, thus prolonging life.

He found that happy people were more inclined to watch their weight, were more perceptive of symptoms of illness, and generally lived healthier lives.

The author explained: "Chronic unhappiness activates the fight-flight response, which is known to involve harmful effects in the long run such as higher blood pressure and a lower immune response."

References

  • [1] Steptoe A, Wardle J, Marmot M. Positive affect and health-related neuroendocrine, cardiovascular, and inflammatory processes. PNAS 2005 102:6508-6512.

  • [2] Tindle H, Chang YF, Kuller LH, et al. Optimism, Cynical Hostility, and Incident Coronary heart disease and Mortality in the Women's health Initiative. Circulation. 2009;120:656-662

  • [3] Robles TF, Brooks KP, Pressman, SD. Trait Positive Affect Buffers the Effects of Acute stress on skin Barrier Recovery. Health Psychology 2009, Vol. 28, No. 3, 373-378.

  • [4] Cohen, S, Doyle, WJ, Turner, RB, Alper, CM, Skoner DP. (2003). Emotional style and susceptibility to the common cold. Psychosomatic medicine, 65, 652-657.

  • [5] Veenhoven R. Healthy happiness: effects of happiness on physical health and the consequences for preventive health care. 2008. Journal of happiness Studies,Vol 9, 3:449-469.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use