Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Disease
Illnesses Associated With Pasteurized, Homogenized Milk
Posted by HealthyMuslim, in Disease
Topics: Pasteurized Milk Homogenized Milk Milk

  Mail To Friend    Printer Friendly Bookmark and Share

From the 15th chapter of the excellent book "The Untold Story of Milk" by Ron Schmid:

MILK-ASSOCIATED ILLNESS TODAY

My familiarity with the work of Weston Price and my clinical experience have convinced me that most illness is the direct result of eating processed foods. Dairy foods - nearly 100 percent of which are highly processed - make up a significant portion of the diet of most Americans. So it is no exaggeration to state that pasteurized, homogenized milk and milk products are closely associated with most of the disease with which Americans suffer.

And suffer we do. Nearly 600,000 Americans die of heart disease every year, and almost as many die of cancer. One of every 15 adults is diabetic. Forty-three million of us have been diagnosed with arthritis. With just five percent of the world's population, America has over 12 percent of the multiple sclerosis patients.

Allergies afflict about 38 percent of all Americans, according to a recent survey. Untold millions of children suffer with ear infections and undergo subsequent surgical treatment. The incidence of all of these and most other diseases has risen drastically during the past 100 years. And during those years, processed pasteurized dairy foods have replaced fresh raw milk products in the diet of nearly all Americans.

Most of us think of milk-associated illness as acute gastrointestinal distress caused by consuming a tainted particular portion of milk or a milk product. When we examine problems of this nature reportedly caused by both pasteurized and raw milk, we should keep in mind the full range of chronic illness in America today. The lack of good quality raw dairy foods and the generally poor quality of their modern processed counterparts have played a fundamental role in the deterioration of our national health.

ALLERGIES AND ILLNESSES ASSOCIATED WITH pasteurized milk

For many individuals allergies are the clearest manifestation of acute illness caused or aggravated by milk and other dairy products. Many articles in medical journals describe allergies to milk in babies and young children. The authors never mention the fact that the allergies are always to pasteurized milk; the alternative of raw milk goes unrecognized and unmentioned. In one study, 59 of 787 babies studied were found to have the classic allergic symptoms of recurrent nasal congestion and bronchitis, eczema, diarrhea or repeated vomiting in response to pasteurized milk or milk-based formula. In other studies the percentages of babies allergic to milk have been even higher. These children saw their doctors much more frequently and required hospitalization more often than children who were non-allergic. The earlier the babies were exposed to pasteurized milk, the more likely they were to show signs of intolerance.

A more serious complication was described by investigators who worked with ten- to thirteen-year old children with a kidney disease called nephrosis, which involves the loss of excess amounts of protein from a damaged kidney. Fluid accumulation with swollen hands and feet is commonly the result, and the problem can lead to permanent renal disease and death. When pasteurized milk was removed from the diet, the children showed signs of marked improvement, and when the milk was reintroduced, the problems returned. The researchers concluded that sensitivity to milk and other foods played a prominent role in causing the disease. Unfortunately, in this as in other studies, the investigators made no attempt to give raw milk and note the results.

Other physicians have observed additional relationships between pasteurized milk and allergic disease in children. eczema, musculoskeletal pain (growing pains), rheumatoid arthritis and strep infections are just a few of the problems pediatricians have alleviated by eliminating milk from the diet. In my own experience, there is not a single problem that occurs in infants and young children that cannot be helped by eliminating pasteurized milk and dairy products from the diet.

Upper respiratory symptoms, frequent ear infections and asthma are often the most obvious symptoms, but virtually any complaint may be a manifestation of allergy to pasteurized milk, as well as to other processed foods. Of the hundreds of children I've treated, virtually every child whose parents have been willing to eliminate these foods from the child's diet has had marked improvement in symptoms, often with subsequent progress to vibrant good health. Just how far that progress can go is generally determined by the willingness of the parents to learn and implement the principles taught by Weston Price - no easy task but one that can be accomplished when people are willing and have a good teacher.

Physicians have also noted a number of interesting and disturbing relationships between the consumption of pasteurized milk and several serious chronic diseases. Investigators at the Baylor College of medicine found that the factors that characterized patients with Lou Gehrig's disease included exposure to lead and mercury and high consumption of pasteurized milk. A number of pediatricians have noted milk allergy in juvenile rheumatoid arthritis. In Don't Drink Your milk, Oski quotes pediatrician Dan Baggett:

I have had several children with signs and symptoms of early rheumatoid arthritis. Without exception, during the past eight years, I have had the good fortune to relieve them and watch their certain return to good health by simply eliminating all traces of milk from their diet.

Oski notes that many other pediatricians have had similar experiences. He also comments on the "many subtle and puzzling forms" milk allergy may take. Other investigators have found a relationship between heavy milk drinking and antisocial behavior. Young criminals were found to drink almost ten times the amount of milk that was drunk by the control group.

It is heartening to note that elements of the medical establishment are realizing that pasteurized milk and milk products play a key role in causing these various problems. But it is disheartening that physicians still lack understanding of the beneficial role of raw milk. The position of the CDC, the FDA, the federal, state, and local public health services, the medical journals, and every professional organization in the conventional medical, veterinary, and public health professions is one of overwhelming opposition to raw milk. This makes it difficult or impossible for the individual physician, pediatrician or otherwise, to suggest raw milk for his or her patients.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use