Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home General
Book: Curing the Incurable: Vitamin C, Infectious Diseases, and Toxins - Thomas E Levy
Posted by HealthyMuslim, in General
Topics: Vitamin C

  Mail To Friend    Printer Friendly Bookmark and Share

From the introduction to the book:

Amazingly, Vitamin C has actually already been documented in the medical literature to have readily and consistently cured both acute polio and acute hepatitis, two viral diseases still considered by modern medicine to be incurable, regardless of the treatment used. It should be understood that both polio and hepatitis may sometimes spontaneously resolve, either relatively quickly or over a more prolonged period of time. However, modern medicine does not seem to be aware that properly dosed Vitamin C will reliably and quickly cure nearly all cases of acute polio and acute hepatitis. Polio babies are completely well in less than a week, and hepatitis patients are sick for only a few days, not several months. Furthermore, chronic hepatitis does not develop in acute hepatitis patients treated with sufficient Vitamin C.

Vitamin C has also reversed and often cured many of the other common viral and bacterial diseases that continue to plague both children and adults. While a great deal of evidence exists to further demonstrate that properly dosed Vitamin C can reverse and almost always prevent other significant medical conditions such as cancer and heart disease, the best documented and most compelling evidence involves the cure of multiple infectious diseases that cause great suffering and often kill or incapacitate. As the reader witnesses a sampling of the enormous quantity of hard scientific evidence that has been virtually ignored on the effective treatment of infectious diseases with Vitamin C, it will be much easier to comprehend that many more, although less well-documented, applications of Vitamin C remain equally unappreciated.

Acute viral hepatitis...is easily and completely curable with treated promptly with adequate doses of Vitamin C ...some evidence indicates that a high dose of Vitamin C for a long enough period of time would probably resolve (chronic hepatitis) as well in many of the cases.......A significant benefit of properly dosed Vitamin C would be the elimination of any need or reason to vaccinate people against hepatitis

All three children had different doctors. The little girl under Klenner's care was given 10,000 mg of Vitamin C as a slow intravenous "push" with a 50 cc syringe every eight hours for the first 24 hours and then every 12 hours for two more doses. Following this she was given 1,000 mg of Vitamin C every two hours by mouth. Klenner also notes that a 40,000-unit dose of antitoxin was injected into the little girl's abdomen. The other two children received the antitoxin as well, but they did not receive any Vitamin C. They both died but Klenner's patient survived, later becoming a nurse.

These are all quotes from the author. See the book at Amazon.Com

Reviews on Amazon.Com

Having seen Vitamin C infusions first hand,having witnessed complete remissions of brain tumor,malignant melanoma,and adenocarcinoma,having used sodium ascorbate on my asthmatic daughter to stop her coughing at night when she had a cold, having crusaded for linus pauling to the condemnation of my medical colleauges,this book is a wonderful compilation of data that strongly implicates the AMA as being negligent in their oath and responsiblities.

This book officially affirms what I've been living for years. I have treated successfully oral herpes, chicken pox, mononucleosis, and respiratory viral infections for years in myself, my wife, and my family.

Finally, a vindication for linus pauling and great news for the human race. This book is the truth!!! The whole truth!!!!

I might have been a bit skeptical of Dr. Levy's assertions until my own advanced cold was virtually wiped out after getting 100 grams of Vitamin C by vein over a few hours. Many other infections and toxin exposures can be similarly neutralized by enough intravenous Vitamin C. Dr. Levy combines his own experiences with over 1,200 journal references to make his book very compelling reading. This should be a textbook in the medical libraries.

I highly recommend that every nurse, pharmacist, MD, and veterinarian own a copy of this well-written book. There is nothing speculative or sensationalized about it. There is simply case study after case study after case study of information on the viral inhibition and bacterial toxin inhibition capabilities of injectable ascorbate. It is exceptionally well documented and includes over 1200 journal references. They are well enough referenced for one to be able to go verify the content. I WILL be buying more copies of this book to give away. I read a lot of medical and natural healing books, but this one has just been added to my TOP 5 nutritional healing books! A must own reference. Dosing information is very well provided for all ages, body types. I feel quite certain that nobody can read this book and not come away with a renewed awe at the power of the intravenous, intramuscular, and oral uses of Vitamin C (actually it is not a vitamin).

Tons of research on C since this book that has validated many of the claims - especially with regards to serious things like Aids. No studies to date that contradict any of the claims in this book. Now the Codex is trying to require a prescription for large doses of Vit C, simply because it causes diahrea (so they say). We all know the real reason. Levy - put it into words.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use