Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Prophetic Medicine
Ibn al-Qayyim: Aloe has Many Benefits for Cleansing, Headaches, and Other Ailments
Posted by SoundHealth, in Prophetic Medicine
Topics: Aloe Aloe Vera

  Mail To Friend    Printer Friendly Bookmark and Share

Ibn al-Qayyim in his Prophetic Medicine said about aloe:

"Aloe is very beneficial, especially Indian variety; it cleanses the bilious superfluities in the brain and the optic nerves; when applied as ointment on the forehead and temples with rose water, it is beneficial for headache. It is beneficial for ulcers of the nose and mouth, and purges black bile and melancholy.

Persian aloe sharpens the intellect, strengthens the heart and cleanses the bilious and phlegmatic superfluities from the stomach, when two spoonfuls are drunk in water. It restores the jaded and spoilt appetite. When drunk in the cold, there is fear lest it purge blood."

What Is aloe?

Aloe is a family of flowering plants in the Lily family, which have thick, juicy flesh stalks. Aloe can also refer to the sappy liquid that the plant excretes when its stalks are cut open.

The aloe plant is made up of water, 20 minerals, 12 vitamins, 18 amino acids and 200 active plant compounds (phytonutrients).

aloe vera is a species of aloe and is the most commonly used type of the plant for healing purposes. It is known as a powerful healing ointment, and many studies have shown that aloe is beneficial in speeding the healing of burns, sunburns, cuts, bites, rashes, and lesions, as well as other conditions like indigestion.

The anti-inflammatory chemical, B-sitosterol is present in aloe vera, and this is what effectively treats many skin conditions arising from insect bites, plant rashes, allergic eruptions, etc. Along with another ingredient, salicylic acid, aloe greatly reduces the time it takes for skin to heal from minor or severe burns.

Health Benefits of Aloe

The internal use of aloe vera has been linked with improved blood glucose levels in diabetics. Other studies have suggested that oral aloe vera gel may reduce symptoms and inflammation in patients with ulcerative colitis. Compounds extracted from aloe vera have been used as an immunostimulant that aids in fighting cancers in cats and dogs; however, this treatment has not been scientifically tested in humans.

Aloe vera extracts have antibacterial and antifungal activities. For example, aloe vera extracts have been shown to inhibit the growth of fungi that cause tinea (fungal infections of the skin), but this has not been proven in humans. For bacteria, inner-leaf gel from aloe vera was shown to inhibit growth of the Streptococcus and Shigella species of bacteria.

Research conducted in Spain showed that a thin layer of aloe vera gel was highly effective in preserving foods. For the experiment, they dipped table grapes into an aloe vera gel, and then stored them at refrigerator temperatures. Untreated table grapes went bad in 7 days, but the grapes dipped in aloe vera stayed fresh for an astonishing 35 days.

Tips on Using Aloe

  • Aloe plants can be grown as house plants and in warmer climates can be cultivated outside in the garden.

  • Pure aloe gel can be purchased to use on sunburns, bee stings, nettle stings, grass rashes, blisters, small cuts, scrapes, and lesions. Since it is a clean, alcohol-free, mild, non-oily, and soothing balm, it is useful to have as a pain-free treatment of every day skin irritations.

References for further study

  • King GK, Yates KM, Greenlee PG, et al (1995). "The effect of Acemannan Immunostimulant in combination with surgery and radiation therapy on spontaneous canine and feline fibrosarcomas". Journal of the American Animal Hospital Association 31 (5): 4394

  • Darokar MP, Rai R, Gupta AK, Shasany AK, Rajkumar S, Sunderasan V and Khanuja SPS (2003). Molecular assessment of germplasm diversity in aloe spp. using RAPD and AFLP analysis. J Med. Arom. Plant Sci.25(2): 354361.

  • Sumbul Shamim, S. Waseemuddin Ahmed, Iqbal Azhar (2004) antifungal activity of Allium, aloe, and Solanum species. Pharmaceutical Biology 42 (7) 491498.

  • Langmead L, Feakins RM, Goldthorpe S, et al (April 2004). "Randomized, double-blind, placebo-controlled trial of oral aloe vera gel for active ulcerative colitis". Alimentary pharmacology & therapeutics 19 (7): 73947.

  • Yongchaiyudha S, Rungpitarangsi V, Bunyapraphatsara N, Chokechaijaroenporn O. (1996) Antidiabetic activity of aloe vera L juice. I. Clinical trial in new cases of diabetes mellitus. Phytomedicine 3: 241243.

  • Bunyapraphatsara N, Yongchaiyudha S, Rungpitarangsi V, Chokechaijaroenporn O. (1996) Antidiabetic activity of aloe vera L juice. II. Clinical trial in diabetes mellitus patients in combination with glibenclamide. Phytomedicine 3: 245248.

  • Schmidt JM, Greenspoon JS (1991). "Aloe vera dermal wound gel is associated with a delay in wound healing". Obstet Gynecol 78 (1): 1157.

  • "Final report on the safety assessment of aloe andongensis extract, aloe andongensis leaf juice, aloe arborescens leaf extract, aloe arborescens leaf juice, aloe arborescens leaf protoplasts, aloe barbadensis flower extract, aloe barbadensis leaf, aloe barbadensis leaf extract, aloe barbadensis leaf juice, aloe barbadensis leaf polysaccharides, aloe barbadensis leaf water, aloe ferox leaf extract, aloe ferox leaf juice, and aloe ferox leaf juice extract". Int. J. Toxicol. 26 Suppl 2: 150. 2007.

  • Tanaka M, Misawa E, Ito Y, Habara N, Nomaguchi K, Yamada M, Toida T, Hayasawa H, Takase M, Inagaki M, Higuchi R (2006). "Identification of five phytosterols from aloe vera gel as anti-diabetic compounds". Biol. Pharm. Bull. 29 (7): 141822.

  • Serrano M, Valverde JM, Guillén F, Castillo S, Martínez-Romero D, Valero D (May 2006). "Use of aloe vera gel coating preserves the functional properties of table grapes". Journal of agricultural and food chemistry 54 (11): 38826.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use