Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home Prophetic Medicine Hijaamah (Cupping)
Hijaamah (Cupping Therapy) as Therapy and Medicine
Posted by HealthMeansWealth, in Hijaamah (Cupping)
Topics: Hijaamah Wet Cupping Cupping Dry Cupping

  Mail To Friend    Printer Friendly Bookmark and Share

Cupping (hijama) has been practised for over 7000 years and can be traced back to the ancient Egyptians, Babylonians and ancient Chinese civilisations. It pre-dates the revelation of the Qur'an, but its practice has been firmly established by the Sunnah and encouraged by the angels. Practising hijama brings about not only good health, but also reward from Allah.

The word "hijama" is derived from "hajm" which means "sucking." cupping is the process of applying cups to various points on the body by removing the air inside the cups to form a vacuum. It was the most recommended medical remedy by the Messenger (sallallaahu alayhi Wasallam) who said, "Indeed the best of remedies that you have is cupping ..." (Bukhari).

Types of cupping

  • dry cupping - This is the process of using a vacuum on the painful areas of the body in order to gather the blood in that area without incisions (small, light scratches made by a razor).

  • Dry massage cupping - This is similar to dry cupping but olive oil is applied to the skin (before applying the cups) in order to allow easy movement of the cups.

Dry and massage cupping may be administered any time of the day, any day of the week or month. There are no restrictions. These two types of cupping are not from the Sunnah. However, they fall under the general teachings of the Messenger (sallallaahu alayhi wasallam) who said, "For every disease there is a cure so if the [appropriately-given] medicine coincides with the disease it cures it by the will of Allah, the Most High." (Muslim).

  • wet cupping - This is the process of using a vacuum at different points on the body but with incisions in order to remove 'harmful' blood which lies just beneath the surface of the skin. It is recommended that this type of cupping is administered by a cupping therapist.

Wet cupping is from the Sunnah. To obtain maximum benefit from cupping, it is recommended that all three methods of cupping are used.

Hijama as a Form of Preventative medicine

The Messenger (sallallaahu alayhi wasallam) said, "Whoever wants to perform cupping then let him search for 17th, 19th and 21st and let none of you allow his blood to rage (boil) such that it kills him." (Saheeh Ibn Majah).

Hijama as a Form of Therapy

The Messenger (dallallaahu alayhi wasallam) used or recommended hijama for:

  • Headaches: (Abu Dawud);
  • Magic: Ibn Al-Qayyim (may Allah have mercy on him) mentions that the Messenger (sallallaahu alayhi wasallam) was afflicted with magic and was cupped on the head to treat it. He also mentions that hijama is from the best of cures for magic if performed correctly (Zaad al Ma'aad).
  • Poison: Abdullah ibn Abbas t reported that a Jewish woman gave poisoned meat to the Messenger of Allah (Sallallaahu Álayhi Wasallam) so he r sent her a message saying, "What caused you to do that?" She replied, "If you really are a prophet then Allah will inform you of it and if you are not then I would save the people from you!" When the Messenger (sallallaahu alayhi wasallam) felt pain from it, he r performed cupping (Ahmad).
  • Strengthening One's intelligence and Memory: The Messenger said, "Cupping & improves the intellect and the memory &" (Ibn Majah).

The Best Time to Practise hijama

Some ahadith describe the days of the lunar month, the days of the week and the exact places on the body where it may be performed.

  • The best days of the month to practise hijama are the 17th, 19th or 21st of the lunar month, based on the hadith: "Whoever performs cupping (hijama) on the 17th, 19th or 21st day (of the Islamic, lunar month) then it is a cure for every disease." (Abu Dawud).
  • The best days of the week, the Messenger (sallallaahu alayhi wasallam) said, "Whoever is going to be cupped then (let it be) on a Thursday in the name of Allah. Keep away from being cupped on a Friday, Saturday and Sunday. Be cupped on a Monday or Tuesday. Do not be cupped on a Wednesday because this is the day that Ayoob was befallen with a trial. You will not find leprosy except (by being cupped) on Wednesday or Wednesday night." (Ibn Majah).

From these two hadith, we deduce that the best days for cupping are the 17th, 19th and 21st of the lunar month which coincide with Monday, Tuesday or Thursday.

Areas of hijama

The Messenger (Sallallaahu Álayhi Wasallam) was cupped on the following parts of his body:

  • The two veins at the side of the neck and the base of the neck (Abu Dawud and Ibn Majah);
  • on his head (Bukhari);
  • on his hip for a pain in that area (Abu Dawud);
  • on the top of his foot, for a pain in that area (Abu Dawud);

Ibn al-Qayyim (may Allah have mercy on him) said, "Cupping under the chin is beneficial for pain in the teeth, face and throat, if it is performed in its proper time. It purifies the head and the jaws. Cupping on the top of the foot is a substitution for the puncturing of the saphena, which is a large vein in the heel. It is beneficial for treating ulcers that occur on the thighs and calves, the interruption of menses and skin irritation on the testicles. Cupping at the bottom of the chest is beneficial for the treatment of sores, scabies and mange on the thighs. It helps against gout, hemorrhoids, elephantiasis and itchiness on the back" (Zaad al-Ma'aad).

Hijama For Women

There is a misconception amongst some sisters who believe that cupping is only for women who have reached their menopause. One example from the Sunnah to dispel this is that the Messenger (sallallaahu alayhi wasallam) instructed someone to cup Umm Salamah.

The Benefits of hijama

  • Stimulates and strengthens the immune system;
  • Enhances blood circulation;
  • Stimulates tissues and internal organs;
  • Improves physical and mental health conditions;
  • Enhances general health of body;
  • Reduces stress and depression by releasing chemicals in the brain;
  • Allows tissues to release toxins by eliminating them through the surface of the skin;
  • Is the best deep tissue massage;
  • Brings blood and warmth to an affected organ and therefore promotes healing;
  • Reduces unwanted side effects of drugs, removes their residue and reduces the risk of drug toxicity;
  • Massage cupping over the digestive system stimulates the inside of the organs, their peristaltic movement and secretion of digestive fluids; strengthens the power of digestion and absorption of nourishment and the power of secretion;
  • dry cupping is 10 times more effective than acupuncture;
  • cupping works in a radius of 10cm and depth of 10-12cm;
  • Massage cupping on the liver aids it to detoxify the body;
  • Massage cupping over the back, revitalises the organs, improves blood circulation and is the equivalent of walking 2km.

The greatest benefit, however, is that it revives a Sunnah. The Messenger (sallallaahu alayhi wasallam) said, "Whoever revives a Sunnah from my Sunnah, and the people practise it, shall have the same reward of those who practise it without their reward diminishing..." (Ibn Majah).

Source: HealthMeansWealth


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use