Sunday, 05 February 2012    HomeAbout UsContact Us    









You are here: Home Disease
Dr Linus Pauling, Vitamin C Infusions and Cancer
Posted by HealthyMuslim, in Disease
Topics: Vitamin C Cancer Linus Pauling

  Mail To Friend    Printer Friendly Bookmark and Share

Dr linus pauling, often referred to as the "Father of Vitamin C" and twice awarded the Nobel Prize, declared that large intakes of up to 10 grams of Vitamin C each day aids anti-cancer activity within the body.

Pauling was largely ridiculed for making these declarations, but today, large doses of Vitamin C are used by many practitioners for cancer patients in nutritional therapies, who believe Pauling was right and that Vitamin C is indispensable to the body in its fight to regain health from cancer.

The following are just some reports in the mainstream media about contemporary research that is now confirming Pauling's claims close to forty years ago.

You will notice in most of these reports that the "Cancer Research UK" spokeswoman is quickly on the scene attempting to dismiss what has been consistently proven over the past 50 years. You should realize that most of these cancer organizations are funded by the pharmaceuticals and their role is to "gate keep" on behalf of the pharmaceutical corporations. That is to keep the lid on, or to dismiss proven low cost, natural, non-patentable, nutritional-based treatments for cancer.

However, the point is that there is now at least some open acknowledgment of the use and benefit of Vitamin C in the treatment of cancer.

Vitamin C, Dr Pauling was right all along. A doctor's opinion

It is the 10th anniversary of the death of linus pauling and his most controversial scientific conjectures about the health benefits of Vitamin C are being confirmed. The weight of evidence may yet force the medical establishment to accept his ideas on nutrition and health.

Linus Pauling's claim, that he knew a cure for heart disease, cancer and infections, was greeted with ridicule. His remarkable health claims concerned the substance we know as Vitamin C. Now, ten years after his death on 19th August 1994, his revolutionary ideas are finally on the way to vindication. Given his history, it should not surprise us if Pauling was right all along. He was, after all, the leading chemist of the last century and, arguably, the greatest ever American scientist. He remains the only person to have won two unshared Nobel Prizes, the first for Chemistry (1954) and the second for peace (1962). In addition to being one of the greatest scientists ever, he was a renowned humanitarian.

By the time of his death, the medical establishment had branded Pauling a quack, because he advocated the use of high doses of Vitamin C to treat many diseases. Irwin Stone first introduced Pauling to Vitamin C, and explained that it wasn't really a vitamin at all, but an essential substance we could no longer manufacture in our bodies. Most animals make their own Vitamin C, in large amounts. In humans, the gene for this ability has mutated and no longer works properly.

When Pauling looked into Stone's claims, he found that conventional medicine had long ignored evidence from respected physicians and scientists. This research suggested that high doses of Vitamin C might be a cure for many illnesses, including cancer and heart disease. However, when he explained these findings in his wonderfully constructed books "Vitamin C and the Common Cold" and "How to Live Longer and Feel Better", the medical profession was incensed, implying that a mere chemist could not possibly understand the intricacies of medical science.

If Pauling was correct, Vitamin C could help overcome the major killers in the industrialised world. This sounded so unlikely that a lesser scientist making the claim would probably have been ignored; the medical world had already disregarded similar reports of Vitamin C. Linus pauling had a reputation for being 20 years ahead of other scientists.

He may well have been years ahead in other fields but, in medicine, the insiders considered such a thing to be impossible. Pauling battled with the medical authorities and convinced a lot of the public of the benefits of high dose Vitamin C. He took on the medical establishment because the implication for health was enormous: an end to premature death and unnecessary suffering from heart disease, infection and many cancers.

Since Pauling's death, the medical establishment has reclaimed the scientific position with a series of experiments on Vitamin C. In particular, the NIH measured the distribution of Vitamin C in the body and claimed that Pauling was wrong about the need for high doses, as the blood could be saturated at low doses [Proc. Natl. Acad. Sci. USA, 93, 3704-9.]. They added that doses higher than one gram were potentially dangerous. From this point on, the high dose Vitamin C lobby were on the defensive.

If the body could be saturated at low doses, the argument went, higher doses were simply a waste or even potentially dangerous. However, clinical reports of the utility of high dose Vitamin C had been repeated in the literature for over 50 years. These reports continued, particularly in the fields of heart disease, infections and cancer, contradicting the NIH conclusions. Either the clinical reports of the efficacy of high doses were incorrect, or the NIH experimental work was flawed.

Taking note of this inconsistency, Drs Steve Hickey and Hilary Roberts decided to investigate the data for a book ("Ascorbate, the science of vitamin C"). They began by looking at the apparently ludicrous claims for the medical effects of Vitamin C. Pauling had stated that the substance could cure cancer and that shortage was the major cause of heart disease. Among his many scientific advances, Pauling had made occasional errors: perhaps he had done the same with Vitamin C. If he was wrong, his hypotheses should be easy to refute.

When they examined the evidence, Hickey and Roberts found background evidence for Pauling's ideas from independent scientific and medical reports, covering half a century. The findings in these papers could neither be dismissed as placebo effects nor easily explained. The reports included remission of AIDS, cures for cancer, and the immediate recovery of children at the point of death from septic shock. The claims seemed so out of the ordinary that they were hard to believe. However, Hickey and Roberts could find no counter examples in the scientific or medical literature.

If these positive reports were indeed wrong, no-one had shown this to be true. The scientific evidence was consistent with Pauling's ideas, with a few notable exceptions. The primary exception was the NIH data on blood and tissue saturation. The medical establishment accepted the NIH conclusions and held them in the highest regard. The US Institute of medicine had based their official recommended dietary allowance (RDA) on these results. If the NIH was correct, then Pauling was wrong and the positive reports of high doses must be invalid.

The NIH conclusions were not correct, however. Hickey and Roberts examined their experiments and found them to be full of errors. For example, the researchers had given a dose of Vitamin C, waited until it had been excreted and then measured blood levels. Using this procedure, they found that increasing the dose did not greatly increase the blood levels. Instead of realising that this was because the dose had been excreted, the NIH claimed it was because the body was saturated, so higher doses were redundant. They then used white blood cells as a model for normal cells, to see how they absorbed Vitamin C from their surroundings. These white blood cells are specialised to absorb Vitamin C, even when supplies are low. If other body cells were similar to white blood cells, we would normally have a reserve of 40 grams in our bodies. In this case, given the proposed RDA of 200mg, it would take 2-3 years to fill a depleted body. This is demonstrably incorrect: the classic example is that James Lind's sailors recovered from scurvy in a matter of days when they were given citrus fruits containing small amounts of Vitamin C.

These mistakes were gross and unsupportable. In order to check their re-interpretation of the data, Hickey sent emails to the NIH, the Institute of medicine and every scientist he could contact who was associated with the RDA, asking them to provide a reasonable scientific response to these errors. No-one was able to provide such a response. Since it is normal scientific practice to explain and defend your ideas, the hypothesis that people only need small amounts of Vitamin C looks increasingly shaky.

Even the NIH's subsequent data contradicts their earlier work. The NIH Vitamin C group published a series of papers on Vitamin C and cancer [Ann Intern Med, 140(7), 533-7.]. In these papers, they suggested that repeated doses of oral Vitamin C would produce blood levels of at least 220 microM (a measure of the concentration) , which is three times greater than the 70 microM maximum "saturated" value they claimed in their RDA papers. While their own papers clearly showed that their low-dose claims were wrong, the NIH appeared not to notice. Instead, they suggested that intravenous doses could produce higher blood levels, which might be effective against cancer. Even though their data were coming closer to Pauling's findings on the use of Vitamin C in cancer, the NIH took the opportunity to mount another attack on linus pauling, suggesting he did not know the difference between oral and intravenous (IV) Vitamin C.

Pauling had performed a series of trials with Dr Ewan Cameron, a Scottish cancer specialist, showing that intravenous Vitamin C allowed cancer patients to live much longer than expected. Numerous other studies confirmed this effect, particularly the work of Dr Abram Hoffer and Dr Hugh Riordan. The Mayo Clinic tried to refute this research but failed, as they used low, oral doses, making their results invalid. In their own cancer paper, the NIH researchers claimed that Pauling and Cameron's use of the IV route was "serendipitous", implying that Pauling did not know the difference between injected and oral doses. In fact, Pauling had written explicitly about this difference, so the NIH criticism was misplaced.

A new scientific theory, called the dynamic flow model, explains all the observed responses to Vitamin C in the literature. This model is described in the book "Ascorbate", mentioned above. According to the model, people should ideally be in a state of dynamic flow, which means they should ingest more Vitamin C than they need, in the form of divided dose supplements. The extra ascorbate flows through the body and is excreted in the urine. It is not wasted, however, as the excess acts as a reservoir when extra Vitamin C is required. Dynamic flow is the closest we humans can get to restoring our physiology to how it was before we lost the ability to make Vitamin C in our bodies, as most other animals still do.

It is difficult to imagine what linus pauling would have made of all this had he lived. Hickey and Roberts like to think that he would have pointed out the NIH errors earlier. He might have had fun explaining that the NIH could not perform a simple experiment, yet tried to blame him for the deficiencies in the Mayo Clinic's research. It is now 10 years since Pauling's death. Biologist Ren Dubos suggested that the mainstream converges with Pauling twenty years later. If so, we only have another decade to wait until the medical establishment can admit that Pauling was right all along.

Dr. Hilary Roberts


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use