Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Prophetic Medicine Honey
Manuka Honey as a Medicine
Posted by SoundHealth, in Honey
Topics: Manuka Honey Honey

  Mail To Friend    Printer Friendly Bookmark and Share

Manuka honey comes from the flower of the manuka bush (Leptospermum scoparium) that is native to New Zealand and has been found to have amazing antibacterial properties. Whilst all honey has some level of antibacterial action, produced by enzymes in the honey, some honeys are more potent than others.

Honey has long been used for medical purposes both internally for relief from coughs, colds, stomach pain, indigestion, ulcers, etc, and externally to heal wounds and cuts. Ibn al-Qayyim described some of the many benefits of honey in his Prophetic medicine. He said that "nothing of this kind has been created for us which is more excellent, nor even similar or near to it in quality", and mentioned many of the healing, cleansing and preserving benefits of honey for the body, which are detailed in a previous article.

Modern research has investigated the healing properties of manuka honey and numerous studies have found it to be a powerful antimicrobial and antifungal when applied topically and ingested.

Fights Superbugs and Heals Wounds

In separate studies, researchers found that manuka honey is able to combat MRSA, a hospital infection that is resistant to all but the most powerful antibiotics. They found that the honey inhibited the growth of the bacteria even at very low concentrations. Another study found that bandages soaked in manuka honey given to cancer patients a Manchester hospital, reduce their chances of contracting the MRSA superbug and lessened wound inflammation following surgery. This honey is now used routinely and is licensed for use in NHS hospitals for dressing wounds and as sterilized manuka honey creams.

The honey not only fights infection and aids tissue healing but has been found in clinical trials to reduce inflammation and scarring. It has also been used successfully, when taken orally, on digestive problems, from diarrhea and indigestion to stomach ulcers and gastroenteritis. Its healing properties appear to be due to the presence of the enzyme glucose oxidase, which produces hydrogen peroxide - an antiseptic - and its high sugar concentration, which inhibits bacterial growth.

A study published in the European Journal of Medical Research in 2003 discovered that manuka honey - when compared with conventional treatments for infected postoperative Caesarean sections and hysterectomy wounds - had an 85 per cent success rate compared with 50 per cent for routine treatments.

Fights Gum Disease

Despite its sweetness, manuka honey has been found to disrupt three types of bacteria in the mouth which cause tooth decay.

In laboratory tests, it sharply reduced the acid levels produced by Streptococcus mitis, Streptococcus sobrinus and Lactobacillus caseii.

Research by Professor Molan, a biochemist and director of the honey Research Unit at the University of Waikato, has shown that reducing the amount of acid stops the bacteria from producing dextran, which sticks dental plaque to the surface of teeth. He recommends rubbing manuka into the gums after brushing or, since it retains its anti-microbial properties even when diluted up to 50 times, it can be used as a mouthwash.

Soothes Sore Throats

Some forms of manuka honey have been linked to fighting infections, such as the bacteria streptoccous pyogones, that causes sore throats. Professor Molan found that taking a teaspoon three times a day, and keeping it in the mouth for as long as possible before swallowing, prevented most throat infections from developing or worsening.

Boosts Endurance

Using honey, including manuka honey of varying strengths, during exercise was found to be as successful at improving performance and power among athletes as specialist energy drinks. Researchers found three to five teaspoons of honey reduced the time to complete a 64 km time trial by more than three minutes and improved cycling power by 6 per cent compared to a placebo.

Unique Manuka Factor (UMF)

So strong is its anti-bacterial component, that manuka honey has been given its own classification, the Unique Manuka Factor (UMF). Strengths range from UMF5, which is believed to be equivalent to a 5 per cent solution of a standard antiseptic, to UMF20, which is equivalent to a 20 per cent solution of antiseptic. Different strengths are recommended for treating different conditions.

Manuka honeys below UMF 10 are recommended for maintaining general health and good digestion. UMF10 to UMF15 are for indigestion, heartburn and diarrhea. They can also be used externally on cuts, grazes, burns, fungal infections and wounds. UMF20 can treat gastroenteritis and stomach ulcers. There are also manuka honey creams for cold sores and skin conditions like eczema and acne.

Some Facts about Honey

  • The nutritional value of honey varies depending on how it is produced and processed. The price of honey is usually a good indication of its quality. Mass produced, blended, imported honey is cheap, has very little flavor and bears little resemblance to real honey.

  • Honey contains an amazing substance called propolis; a natural antibacterial produced by the bees to protect the hive from infection. That's why real honey never grows mould or goes off.

  • Naturally produced, unfiltered honey contains pollen grains, making it an effective treatment for hay fever. Eating honey from your local hives, where the bees feed on the plants that trigger your allergies, can alleviate the symptoms of hay fever.

Here is a comprehensive list of research papers and publications about manuka honey


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use