Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home General
Some Herbs to Grow with Medicinal and Culinary Benefits
Posted by SoundHealth, in General
Topics: Herbs Rosemary Sage Mint Perppermint Lemon-grass

  Mail To Friend    Printer Friendly Bookmark and Share

Here are a few herbs that boast both medicinal and culinary properties, so not only will they flavor your dishes, you can also gain health-promoting benefits from them.

These herbs are all easy to grow and by having them growing in your garden you can have them at hand all year round.

rosemary

Rosemary (Rosmarinus officinalis) is an aromatic and intensely-flavored herb that has long needle-like evergreen leaves and belongs to the mint family. All varieties of rosemary as effective medicinally and for culinary purposes, and because they are evergreen, their leaves can be picked all year round.

Studies have identified a number of polyphenolic compounds in rosemary that have antioxidant activity, and inhibit oxidation and bacterial growth such as E. coli.

Research found that rosemary extract had a protective effect on human blood exposed to radiation, and showed strong antimutagenic effects, which is associated with preventing certain cancers. Furthermore, carnosic acid, the main polyphenol antioxidant in rosemary, combined with vitamin D, was found to reduce human leukemia cancer cell spread.

Rosemary tea is used an effective remedy for headaches. Roughly chop a handful of fresh leaves and let them infuse in boiling water for about 10 minutes.

Rosemary is commonly available as an established shrub from most garden centers, and its attractive foliage, invigorating scent and range of health-enhancing properties makes it an essential herb to have in the garden.

sage

Sage (Salvia) has velvety, textured leaves, ranging in color and size, and the best medicinal and culinary sages are the ones that have officinalis or lavandulifolia in their name.

Like rosemary, its sister herb in the mint family, sage contains a variety of volatile oils, flavonoids, and phenolic acids, including the phenolic acid named after rosemary - rosmarinic acid. The rosmarinic acid in sage and rosemary also functions as an antioxidant, and reduces inflammatory responses in the body.

Research published in 2003 found that sage is an outstanding memory enhancer, and that the dried root of Chinese sage contains active compounds similar to those used to treat Alzheimer's disease.

Sage is also anti-bacterial and anti-mucosal so it is useful for fighting colds, and clearing catarrh as well as fighting off germs. Its antiseptic properties make it excellent for healing gum problems and sore throats when drunk as a tea or used as a gargle.

Sage plants grow very slowly so the quickest and most reliable way to grow sage is to buy it as a small plant from a garden centre and plant it straight outside.

Sage is a popular herb with a warm, spicy, slightly tangy flavor that can be used to flavor many dishes, and it is an attractive plant to have growing in the garden;

mint

Mint (Mentha) consists of many different species; the most widely grown and used are spearmint, peppermint, orange or bergamot mint and pineapple mint. This herb has many varied culinary and medicinal uses.

Mint contains phenolic compounds that have strong antioxidant activity, and its many vitamins and minerals include Vitamin A, calcium, folate, potassium and phosphorus.

Studies found that the phenolic phytochemicals in fresh mint had very strong scavenging activity, and its high salicylic acid content is thought to play a role in the prevention of colorectal and lung cancer, and atherosclerosis.

Research also found that peppermint oil reduced nausea, spasms and had a soothing effect on sufferers of irritable bowel syndrome.

Menthol, a major component of mint was found to activate a nerve ending that responsed to cold and to menthol, which is thought to explain its cooling sensation and its common use as an inhalant to reduce decongestion in the nose.

Peppermint tea is a really effective aid for digestion and other intestinal ailments, and it also has mild antibacterial and antiseptic properties. Peppermint teabags are now widely available to buy, but it's so easy to grow your own.

Mint plants very invasive and can spread around the garden quickly. To restrict its growth, grow it in a pot sunk in the ground (this will stop its roots from spreading), or grow it in containers.

lemon-grass

Lemon-grass (Cymbopogon schoenanthus) is a tropical plant so it grows well in hot climates, or in a heated greenhouse. This herb has long grass-like fragrant leaves and has a citrus flavor, commonly used to flavor teas, soups and curries.

Lemon-grass is rich in Beta-carotene, the powerful antioxidant, and recent studies have found that this herb also has antifungal and antibacterial properties.

The scholar Ibn al-Qayyim in his work on Prophetic Medicine mentioned the following benefits of lemon-grass:

"Idhkhir (lemon-grass) is hot in the second degree and dry in the first; gentle, opening obstructions and the 'mouths' of veins; diuretic, emmenagogue; it breaks up stones, dissolves hard inflammations in the stomach, liver and kidneys, when drunk and used as a poultice. Its root strengthens the bases of the teeth and the stomach; it quietens nausea and restrains the belly."

References

  • Del Bano MJ, Castillo J, Benavente-Garcia O, Lorente J, Martin-Gil R, Acevedo C, Alcaraz M. Radioprotective-antimutagenic effects of rosemary phenolics against chromosomal damage induced in human lymphocytes by gamma-rays. J agric Food Chem. 2006;54:2064-2068.

  • Sharaboni H. Cooperative antitumor effects of vitamin D3 derivatives and rosemary preparations in a mouse model of myeloid leukemia. Int J cancer. 2006 Jun 15;118(12):3012-21.

  • Moreira MR, Ponce AG, del Valle CE, Roura SI. Inhibitory parameters of essential oils to reduce a foodborne pathogen. LWT. 2005;38:565-570.

  • Shan B, Cai YZ, sun M, Corke H. Antioxidant capacity of 26 spice extracts and characterization of their phenolic constituents. J Agric Food Chem. 2005; 53:7749-7759.

  • Samarth RM, Panwar M, Kumar M, Kumar A. Protective effects of Mentha piperita Linn on benzo[a]pyrene-induced lung carcinogenicity and mutagenicity in Swiss albino mice. Mutagenesis. 2006 Jan;21(1):61-6.

  • Spirling LI, Daniels IR. Botanical perspectives on health peppermint: more than just an after-dinner mint. J R Soc health. 2001 Mar;121(1):62-3.

  • McKay DL, Blumberg JB. A review of the bioactivity and potential health benefits of peppermint tea (Mentha piperita L.).Phytother Res. 2006 Aug;20(8):619-33.

  • al-Sereiti MR, Abu-Amer KM, Sen P. Pharmacology of rosemary (Rosmarinus officinalis Linn.) and its therapeutic potentials. Indian J Exp Biol 1999 1999.

  • Calucci L, Pinzino C, Zandomeneghi M et al. Effects of gamma-irradiation on the free radical and antioxidant contents in nine aromatic herbs and spices. J Agric Food Chem 2003 Feb 12; 51(4):927-34 2003.

  • Kelm MA, Nair MG, Strasburg GM, DeWitt DL. Antioxidant and cyclooxygenase inhibitory phenolic compounds from Ocimum sanctum Linn. Phytomedicine 2000 Mar;7(1):7-13 2000. PMID:12240.

  • Malencic D, Gasic O, Popovic M, Boza P. Screening for antioxidant properties of Salvia reflexa hornem. Phytother Res 2000 Nov;14(7):546-8 2000. PMID:12230.

  • Tildesley NT, Kennedy DO, Perry EK, Ballard CG, Savelev S, Wesnes KA, Scholey AB. Salvia lavandulaefolia (Spanish Sage) enhances memory in healthy young volunteers. Pharmacol Biochem Behav. 2003 Jun;75(3):669-74. 2003.

  • Shadab, Q., Hanif, M. & Chaudhary, F.M. (1992) antifungal activity by lemongrass essential oils. Pak. J. Sci. Ind. Res. 35, 246-249.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use