Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Blackberries: Exceptionally High in Disease-Fighting Antioxidants
Posted by SoundHealth, in Nutrition
Topics: Blackberries

  Mail To Friend    Printer Friendly Bookmark and Share

Blackberries are one of the most nutrient-dense of all berries; they packed with powerful antioxidants such as vitamins E and C, folate and fiber, making them useful in the prevention and treatment of heart and circulatory problems, and protective against cancers, degenerative diseases and infections.

Blackberries are shrubs that belong to the rose family, and loganberries are a hybrid of the blackberry. The deep blue and purple colors of blackberries are a leading disease fighting pigment. Foods rich in this brilliant blue color, the anthocyannin pigment, mop up more free radicals in the body than any other food, protecting against disease.

Blackberries are high in antioxidants: an in vitro study found that blackberries had the highest antioxidant capacity when compared with blueberries, cranberries, strawberries and raspberries. They are also rich in Vitamin C, fiber and into the phytochemicals tannin, flavonoid, and cyanidin, as well as ellagic acid, all which have anticarcinogenic properties. Cooking does not seem to destroy ellagic acid, so even blackberry jams and desserts retain ellagic acid health benefits. Blackberries also contain catechins such as quercetin, which is an antioxidant that can reduce the risk of heart disease and stop the action of histamine for people with allergies.

Health Benefits

Natural Remedies

The astringent leaves of the blackberry contain antiseptic tannins, and chopped and used as tea they're an excellent mouthwash for gum problems and infections like gingivitis, as well as an effective gargle for sore throats. The dried leaves soaked in boiled water are also used as an effective remedy for diarrhea.

Breast and Cervical Cancer

Blackberries have recently been pinpointed as a leading source of compounds thought to produce health benefits for women, due to their high concentrations of phytoestrogens. Phytoestrogens, or plant estrogens, are of particular interest because of their roll in prevention of both breast and cervical cancer. Studies now associate blackberries with containing some of the highest levels of phytoestrogens, which act as a natural form of estrogen. Studies in Finland measured eight different berries for their phytoestrogen level, and concluded that blackberries had the highest levels, followed by strawberries.

Colon and Liver Cancer

Human cell studies have shown that components in blackberries capture free radicals and prevent damage to liver and colon cells.

lung cancer

Studies done on human lung cancer cells have shown that blackberry extracts inhibited further growth of the cancer. A rat study demonstrated for the first time that an anthocyanin extract from blackberries (cyaniding-3-glucoside) inhibited tumor promotion and metastasis (the spreading of cancer cells).

esophageal cancer

Blackberries have been shown to inhibit and reduce the growth rate of esophageal cancer in laboratory rats.

Tips for Using Blackberries

References

  • W. M. Mazur, et al. Phyto-oestrogen content of berries, and plasma concentrations and urinary excretion of enterolactone after a single strawberry-meal in human subjects British Journal of nutrition (2000), 83, 381-387.

  • Wang SY, Jiao H. Scavenging capacity of berry crops on superoxide radicals, hydrogen peroxide, hydroxyl radicals and singlet oxygen. J Agric Food Chem. 2000 Nov;48(11): 5677-84.

  • Guerra MC, Galvano F, Bonsi L, Speroni E, Costa S, Renzulli C, Cervellati R. Cyanidin-3-O-betaglucopyranoside, a natural free-radical scavenger against aflatoxin B1- and ochratoxin A-induced cell damage in a human hepatoma cell line and a human colonic adenocarcinoma cell line. Br J Nutr. 2005 Aug;94 (2):211-20.

  • Feng R, Bowman LL, Lu Y, Leonard SS, Shi X, Jiang BH, Castranova V, Vallyathan V, Ding M. Blackberry extracts inhibit activation protein 1 activation and cell transformation by perturbing mitogenic signaling pathway. Nutr cancer. 2004; 50(1):80-9.

  • Ding M et al. Cyanidin-3-glucoside, a natural product derived from blackberry, exhibits chemopreventive and chemotherapeutic activity. J Biol Chem. 2006 Jun 23;281(25):17359-68.

  • Stoner GD, Chen T, Kresty LA, Aziz RM, Reinemann T, Nines R. Protection against esophageal cancer in rodents with lyophilized berries: potential mechanisms. Nutr cancer. 2006;54(1):33-46.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use