Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Sauerkraut (Sour Cabbage) is a Superfood - How to Make It
Posted by HealthyMuslim, in Nutrition
Topics: Sauerkraut Sour Cabbage Lactic Acid Bacteria Lactobacilli Plantarum

  Mail To Friend    Printer Friendly Bookmark and Share

Sauerkraut is a Superfood and Excellent Tonic For the Digestive System

Sauerkraut means "sour cabbage" and refers to finely shredded cabbage which has been fermented by lactic acid bacteria. In this process, the bacteria produce and release the vitamins, minerals and phytonutrients present in the cabbage, creating a pre-digested, highly beneficial food. It is actually the secret to the health and longevity of the cultures and civilizations in whose diet it features heavily. It is an immune booster, a proven cancer fighter, and an excellent digestive aid, and helps to relieve the body of common ailments through regulation and toning of the digestive system.

NOTE: The gut essentially makes up the immune system and is like a brain in its own right - refer to this book. There are ten times more bacteria in your gut, (100 trillion), than there are cells in your entire body, the weight of this amount of bacteria is nearly two kilos, and with the exception of the liver, they collectively form the largest organ inside your body. Each day several ounces are produced and eliminated. The total surface area of your intestine and colon (where these bacteria reside) is larger than a tennis court. These bacteria can exist in a symbiotic (mutually beneficial) relationship with you, or a harmful relationship with you, and these bacteria are crucial to the maintenance and operation of your entire body. This shows that your gut (esophagus, stomach, duodenum, small intestine, colon) is very sensitive ecosystem, is integral to your health and constitutes 80% of your immune system. Many Muslim scholars past and present have stated that all disease has its foundation in dysbiosis (which means impaired digestive ability, putrefaction, fermentation, sensitivity etc. in the gut) and they have likewise stated that the foundation of all medicine is taking precautions in the diet.

NOTE: Sour milk (laban) is milk that has turned acidic, it is the same principle at work, and it is the secret of the good health of many cultures and civilizations, including those who live in the mountainous regions of the Caucasus, the Arabs and others.

How to Make sauerkraut

There are many recipes available and you can use just plain white cabbage, or you can be more adventurous and make up your own speciality. Here we are going to use both white and purple cabbage, and add small onions, bell peppers, carrots, broccoli, and some seeds and herbs to add some flavour. We are going to make a large batch and it will last a few months. Be warned that making sauerkraut, especially in large amounts, will get very, very messy!

Things you will need:

  • Six medium sized white cabbages
  • One large purple cabbage
  • Some broccoli
  • Three bell peppers, green, red, orange
  • Fifteen small white onions
  • Eight medium sized carrots
  • A bulb of garlic
  • Wild rosemary, caraway seeds, mustard seeds
  • A large grater (takes more time) or a food processor (easier!)
  • A few large bowls
  • Three or four Kilner jars
  • Sea salt
  • Boiled water left to cool (preferably not tap water)

Here, seeing is better:




Preparation of the Ingredients

First, take off the outer three or four leaves of the cabbage, and keep hold of them, they will come to use later on. Then shred the cabbage. You will need a large knife to slice the cabbage into sizeable amounts that will fit into your processor. At the bottom of the cabbage is the hard root, you want to cut around that and discard it at the end. You can use a grater (much slower and messier), or you can use a food processor for shredding, you will save a lot of time this way! Slice the bell pepers, slice the carrots into thin pieces (we used the processor), or you can grate them if you want. Peel and cut the onions into half, or you can add them whole, after removing the skin.





Put the shredded cabbage into the large bowls, and then add sea salt. You will need to add a teaspoon for each medium to large cabbage you have used (1.5 teaspoons salt for each kilo of cabbage is a rough guide). Then you will need to mix the salt into the cabbage with your hands, and should be done thoroughly. The salt helps to release the water from the cabbage and this is very important, this helps the fermentation process to initiate after we package the ingredients into the jars. The salt also inihibits pathogens and spoilage organisms, and allows only the good bacteria to thrive.


Then you can add the rest of the ingredients, the onions, broccoli, carrots, garlic cloves and peppers. Finally, you can add the wild rosemary, mustard seeds, caraway seeds, and we also added some black seeds too. Don't add too much, just a bit of each, you want enough to add a little flavour, otherwise, the seeds and herbs might dominate the flavour too much. You should leave this for around 30-60 minutes and you should also mix it thoroughly with your hands and also press and push the cabbage to release the water.


Packing the sauerkraut into Kilner Jars

Now it gets even messier, packaging the jars. Take your jars and add the cabbage mix. You need to really pack it tight, so you will need to form a fist and compact the cabbage as much as possible. Alternatively you can use a roller or something similar if you can't get your fist in. Package it right to the top, making sure you compact it as much as possible, and leave around an inch and a half from the top of the jar. You will notice that a lot of water is released, and as you compact and push the cabbage mix down, it will rise higher.


If you remember the leaves we took off the cabbage at the very beginning, this is where they come in handy. You need to take one leaf and then place it on top of the cabbage mix, and then push it down. The aim is to try and cover the top of the cabbage mix completely. Then, if necessary add the boiled water (after it has cooled) to the jar so as to completely submerge everything. We are ensuring there is no air at all, since the fermentation process is anaerobic.


Get the rest of your cabbage packaged into the kilner jars in the same way.

Fermentation Process

First you need to leave these jars at room temperature (around 21-23 celcious, 70-73 farenheit) for three to four days, and keep them covered with a towel, away from light. This provides the right temperature for the first batch of bacteria to thrive and provide the acidic environment for the later bacteria, the Lactobacillus species. These lactic acid bacteria start to release all the goodness from the cabbage and produce vitamins, enzymes, minerals, phytonutrients and so on.

NOTE: Commercially produced sauerkraut it pasteurised so you will be losing a large share of the benefit as the enzymes will have been destroyed!

After those three or four days, you then need to move the jars to a cooler place (around 15 celcius or 60 farenheit). The longer you leave it, the more mature and better the sauerkraut gets. We normally leave for around 3 weeks. After this you can then place in the fridge in a seal-tight container where it will last for a few months. The juice is extremely healthy, as it will contain a lot of the released nutrients, so you will not want to discard that, but keep it separately and keep it refrigerated.

How To Consume

You can have a portion of sauerkraut daily on its own, or you can add it to meals to aid digestion. It is rich in vitamins, minerals, enzymes and phytonutrients and hence will aid digestion, as well as keep the gut in order, and help maintain bacterial equilibrium, which is integrally tied to health and well-being.

Closing Note

  • The key to good health is eating nutritious food, balanced in the right amounts and keeping the gut (esophagus, stomach, small intestine, colon) in good order. Ensuring your diet consists of a high amount of whole foods and pre-digested foods [foods which contain everything needed to digest it] does away with a) your body having to consume its own resources in order to digest food and b) from having improperly digested food from passing through the gut (which leads to disease conditions). This is the simple secret to the good health and longevity of certain cultures. This is also why those who eat mostly processed and cooked foods (or eat more than what is actually necessary) decline earlier and find many ailments early in age, and are more easily susceptible to contracting diseases, because the body has been consuming much of its own resources and reserves in order to digest deficient food, thereby compromising its robust, healthy state.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use