Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
Olive Oil Is Effective Against A Form of Breast Cancer
Posted by SoundHealth, in News
Topics: Olive Oil Cancer

  Mail To Friend    Printer Friendly Bookmark and Share

A new study shows that olive oil is effective against HER-2 positive breast cancer, a form of breast cancer for which the medical establishment offers little in the way of tolerable treatment.

Olive oil has long been known to have many health benefits. The great scholar Ibn al-Qayyim in his Prophetic Medicine promoted some of its benefits, and more recently many studies have shown its benefits for fighting cancer, heart disease, and an olive oil-rich diet has been linked to long, healthy and happy lives.

This new study in the BMC cancer journal found that the polyphenols from extra virgin olive oil inhibit HER-2 (Human Epidermal growth factor Receptor 2) activity.

Researchers investigated the effects of this growth factor with extracts from commercial extra virgin olive oil in cultured human breast cancer cell lines. They tested for the ability to kill both HER-2 positive and negative tumors.

The lead researcher, Javier Menendez said, "Our findings reveal for the first time that all the major complex phenols present in extra-virgin olive oil drastically suppress overexpression of the cancer gene HER2 in human breast cancer cells".

They found that the main extra virgin olive oil polyphenols had strong tumor killing effects by selectively triggering high levels of apoptotic cell death (programmed cell death). The study concluded that extra virgin olive oil is an excellent and safe treatment targeting HER-2.

Details for the study:

Menendez J A et al tabAnti-HER2 (erbB-2) oncogene effects of phenolic compounds directly isolated from commercial Extra-Virgin Olive Oil(EVOO). BMC cancer 2008, 8:377

Types of Olive Oil

All types of olive oil are sources of monounsaturated fat, but extra virgin olive oil, the oil that comes from the first pressing of the olives, contains higher levels of antioxidants, particularly polyphenols and Vitamin E, because it is less processed.

Olive oil is generally extracted from olives by pressing or crushing them. It is available in different varieties depending on the amount of pressing. These include:

  • Extra virgin oil - this is considered to be the best variety. It is extracted without the use of heat, and is considered a cold-pressed oil. There is no heat or chemicals involved in its processing, so the flavor and nutrients remain intact.

  • Virgin oil - this is from the second pressing. The nutrients and the flavor are less concentrated, and are not what they were the first time around.

  • Pure - this oil has undergone some processing and heat during filtering and refining. A little extra virgin olive oil is added to this refined oil, and creates what is considered a lower grade of oil that is frequently sold under the simple term olive oil.

  • Extra light - oil has undergone considerable processing and has a very mild flavor. In this processing many nutrients are compromised. This type of oil is unregulated by any certification organization and there is no precedent as to what its content should be. Sometimes other vegetable oils have been added to it.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use