Thursday, 23 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut
Posted by SoundHealth, in Nutrition
Topics: Probiotic Prebiotic Immune System Bacteria

  Mail To Friend    Printer Friendly Bookmark and Share

Probiotics and prebiotics are increasing becoming popular as a health food, but what are they, what is the difference between them and why should we take them?

Growing research is finding that one of the keys to good health can be found in our guts - specifically, in the bacteria that live in the digestive tract. These bacteria are known as probiotics, and they have been associated with improving digestive health, reducing inflammation, food allergies, skin conditions, obesity and more.

Probiotics aid the gut by inhibiting harmful bacteria and increasing helpful bacteria, as well as potentially strengthening the body's immune response. At least 70% of the immune system is found in the gut, so keeping this part of the body in peak condition is important for overall good health.

Probiotics are defined by the World health Organization as 'living organisms which, when administered in adequate quantities, confer a health benefit to the host.'

prebiotics on the other hand, are non-digestible food ingredients that provide a food source for these 'friendly' bacteria and so enhance their activity.

The Role of bacteria

Bacteria live in huge quantities all through our body but about 100 trillion are found in our intestines and are harmless bacteria that cause no problems. The good bacteria in our bowels help to inhibit the growth of more harmful bacteria and aid the digestion and absorption of nutrients. In addition, they seem to assist in the normal movement of our bowels (peristalsis), and stimulate the production of proteins that protect the mucous membranes of the body (our 'inner skin').

If the delicate balance of gut bacteria is disturbed, harmful bacteria can multiply and take over, causing problems. The balance of bacteria is different in each of us, so these symptoms can vary, but many people report symptoms such as constipation, diarrhea, bloating and a tendency to infections. Taking antibiotics is also a potential cause for disruption of the bacteria balance since these can kill both friendly and unfriendly bacteria alike.

Other factors affecting the intestinal immune system include a poor diet, medical conditions such as inflammatory bowel disease and lifestyle changes such as stress or weight loss. If the gut immune system is balanced and healthy, this optimizes our natural defences and so helps to fight off infections, maintain health and well-being and allow for faster recovery from illness.

Probiotics aim to rebalance normal bacterial levels in the gut by reducing the population of bad bacteria, discouraging pathogenic organisms from invading the digestive system, reducing inflammation and increasing the absorption of vital nutrients.

Sources of probiotics

Probiotics are found in certain foods such as cultured dairy products like yoghurt and some cheeses, as well as in pickles and sauerkraut - another name for fermented cabbage.

They are also available as dietary supplements, with the bacteria being present originally or added during preparation. Not all probiotics are the same, so when choosing a supplement, look for one where the quality is guaranteed, that provides a sufficient quantity of live, active 'good' bacteria, and that survives the stomach acid. They are also time sensitive so their activity declines the longer they remain unused. This is unlike prebiotics, which are less sensitive and can be stored for many weeks. Always choose a type of supplement that contains at least the bacteria Lactobacillus and Bifidobacterium - the most common type of good bacteria - and swallow them with a cold, not hot, drink.

Who Should Take probiotics

Probiotics should be considered for anyone who has recently had antibiotic treatment, from sufferers of irritable bowel syndrome, those recovering from diarrhea, or for those just wanting to boost their immune system and improve digestive health in general.

prebiotics

Prebiotics are non-digestible food fibers that benefit the body by stimulating the growth of healthy bacteria in the intestines. Therefore, to be effective, the prebiotic must not be digested in the upper gastrointestinal tract, so that is able to be released in the lower tract and used by healthy bacteria in the colon. Unlike probiotic bacteria, prebiotic carbohydrates are not destroyed when they are cooked.

Prebiotics are usually carbohydrates such as oligosaccharides. Oligosaccharides are sugar molecules made up of three to six chains and soluble fiber. They coat mucous membranes and are found in plants, saliva, and breast milk.

The Relationship between prebiotics and probiotics

Probiotic bacteria are not normally found in the intestine and when they are introduced, they are often quickly eliminated. Prebiotic foods are therefore vital in order to encourage probiotic bacteria to survive and thrive. The beneficial bacteria need to be constantly introduced into the body and fed the correct foods to ensure that they stick to the intestinal wall rather than passing straight through the digestive tract.

So prebiotics and probiotics work together in the body to improve the immune system, improve mineral absorption and balance and rid the gut of harmful microorganisms, which helps to alleviate digestive problems like constipation and diarrhea.

Sources of prebiotics

Prebiotics can be found in the following foods:

  • raw oats

  • unrefined wheat

  • unrefined barley

  • bananas

  • berries

  • asparagus

  • garlic

  • flaxseed

  • tomatoes

  • greens

  • legumes

  • chicory root


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use