Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
The Importance of Saturated Fats in the Diet
Posted by SoundHealth, in Nutrition
Topics: Saturated Fat Fats

  Mail To Friend    Printer Friendly Bookmark and Share

Saturated fats have been labeled as "bad" fats, and a common misunderstanding is that reducing saturated fats or fats from the diet altogether means weight loss and better health. However, a reasonable amount of saturated fats in the daily diet is essential for health and longevity, and evidence is showing that saturated fats prevent heart disease, osteoporosis and even cancer.

Saturated fats are mostly from animal foods, but are also found in tropical oils like palm and coconut oils. The saturated fats in our diets are generally derived from four types:

  • stearic (animal fat and chocolate)
  • lauric (coconut oil)
  • palmitic (palm oil, animal products and dairy)
  • myristic (coconut oil and dairy)

Humans have always consumed saturated fats, through animal sources and tropical oils, and saturated fatty acids are found in breast milk; they are essential for growing infants and toddlers. They provide taste, consistency and stability to foods.

Saturated fats are built into cell membranes; they cushion and protect them and provide energy to the kidneys. Palmitic fats are responsible for important signaling and stabilizing processes in the body. When these fats are lacking, cell and organ growth factors become dysfunctional.

Myristic acid stabilizes proteins, including those used by the immune system and those that fight tumors. Stearic acid is converted into an unsaturated fat by liver enzymes during digestion, and lauric acid has antimicrobial properties.

We need saturated fats to absorb the fat soluble vitamins A and D - found in animal fats, organ meats, fish, eggs and shellfish, other nutrients, such as vitamin K, associated with blood-clotting and building bones.

These vitamins are essential for healthy bones, for preventing birth defects and reproductive problems, for proper growth and development, and for preventing diseases such as colon cancer and multiple sclerosis.

Much research has shown that it is not saturated fats that cause heart attacks and high cholesterol levels, but clinical studies strongly suggest that trans-fats and refined and hydrolyzed (hydrogenated) fats found in vegetable oils, margarines, and oxidized polyunsaturated fats are the real "bad" fats, as explained in previous articles.

Protection Against Disease

Furthermore, research has shown that saturated fats are in fact associated with health improvements. For example, a study of more than 60,000 Swedish women, aged 46-70, found that polyunsaturated fats were associated with an increased incidence of breast cancer, while saturated fats were not [1].

As for heart disease, when male albino rats were fed a diet high in polyunsaturated fats such as soybean and rapeseed oils, they showed a high incidence of heart lesions. But, when dietary saturated fats (from cocoa butter) were added to the oils, the number of lesions was significantly reduced [2]. A three-year study of postmenopausal women with heart disease found that, contrary to popular belief, those who regularly consumed more saturated fats actually had less disease progression than those who followed a diet higher in polyunsaturated fats and carbohydrates [3].

A follow-up of the Swedish Malmo diet and cancer Study, which studied the fat intakes of 28,000 middle-aged people for five years, observed no ill effects of a high saturated-fats intake in either men or women [4].

Lipoprotein a, or Lp(a), found in the bloodstream, is a marker for cardiovascular disease. In one double-blind study comparing the effects of eating different types of fats - oleic acid (monounsaturated fats such as in olive oil), and different concentrations of trans fats and saturated fats - the diet that included saturated fats lowered Lp(a) by 8-11 per cent [5]

In fact, in India scientists attribute the increase in heart disease and type-2 diabetes to the replacement of traditional cooking fats, such as ghee (clarified butter) and coconut oil, with polyunsaturated vegetable oils [6].

Summary

There is no scientific reason why natural foods containing saturated fat can't be part of a healthy diet; in fact the body requires fats for overall health, they are essential for a healthy heart and bones, for the absorption of minerals and protection of vital organs. The type of fat consumed holds the key to good health. Processed and refined fats, such as refined hydrogenated oils and trans fats, as well as poor nutritional and lifestyle choices and many other factors, all contribute to the health problems and diseases prevalent in society, as explained in other articles on the site.

References

  • [1] Wolk A, Bergström R, Hunter D, et al. A Prospective Study of Association of monounsaturated fat and Other Types of fat With Risk of breast cancer. Arch Intern Med, Jan 1998; 158: 41 - 45.

  • [2] Kramer JKG, Farnworth ER, Thompson BK, et al. Reduction of myocardial necrosis in male albino rats by manipulation of dietary fatty acid levels. Lipids, 1982; 17: 372-82

  • [3] Mozaffarian D, Rimm EB, Herrington DM. Dietary fats, carbohydrate, and progression of coronary atherosclerosis in postmenopausal women. Am. J. Clinical nutrition, Nov 2004; 80: 1175 - 1184.

  • [4] Leosdottir M,Nilsson PM, Nilsson JA, et al.Dietary fat intake and early mortality patterns - data from The Malmö diet and cancer Study. Journal of Internal Medicine Volume 258, Issue 2, Date: August 2005, Pages: 153-165

  • [5] Clevidence BA, Judd JT, Schaefer EJ, et al. Plasma Lipoprotein (a) Levels in Men and Women Consuming Diets Enriched in Saturated, Cis-, or Trans-Monounsaturated fatty acids. Arterioscler Thromb Vasc Biol. 1997;17:1657-1661

  • [6] Sircar S, Kansra U. Choice of cooking oils--myths and realities. J Indian Med Assoc 1998 Oct; 96(10):304-7.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use