Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Recipes
Amazing Overall Health Boosting, Brain Powering Omega-3 Flax Oil-Protein Recipe From The Budwig Protocol
Posted by HealthyMuslim, in Recipes
Topics: Johanna Budwig Budwig Protocol Flax Oil Flax Seeds Cottage Cheese Quark Brain

  Mail To Friend    Printer Friendly Bookmark and Share

Introducing Johanna Budwig

Over 50 years ago a famous lady by the name of Johanna Budwig, who did some pioneering work on fats, laid out a diet for terminally ill people, based upon the flax seed and its oil that is known to be very high in omega-3 fatty acids. If you haven't woken up yet, omega-3 fatty acids are very good for your health and you need a sufficient intake in your diet.

Unfortunately we are bombarded with the very generic propaganda, "cut down your fats to avoid heart disease". Well that's simply not true! You need to increase your fats, but increase in the good, healthy fats which are omega-3 fatty acids.

So here is a recipe that we have been enjoying for a while after our research and investigation into the Budwig Protocol. We have sourced all available English translations of Johanna Budwig's writings and speeches and studied them. Dr. Budwig was a licensed pharmacist, qualified chemist, had doctorates in both chemistry and physics and was a recognised expert in pharmaceuticals and fats.

Upon discovering the health benefits of "essential fats" (i.e. Omega-3 fatty acids) and the harmful effects of certain other fats, she became the target of the margarine industry and was hounded in and out of court numerous times. In every case she was acquitted with the facts and the science on her side.

That's enough with the history! We know you want the core recipe that forms the underlying basis for the "Budwig Protocol" and with which Dr. Budwig treated hundreds of terminally ill-patients (all documented).

Please note we have already covered a flax seed porridge that is taken from the Budwig Protocol (with our own little modifications including the black seed). You should take a look at that and try to implement it in your diet.

The flax Seed and quark / cottage cheese Base Recipe

This is a base recipe for which you can make scores of variations. This makes one serving for one person. You will need a hand-held blender and a good coffee grinder. You can buy both items from Argos at a cost of around £30).

Ingredients

  • 2 tbsp of flax seed oil
  • 4 tbsp of quark or low fat cottage cheese
  • 1 to 1.5 tbsp of flax seeds (golden linseeds or brown flax seeds) finely-ground in a coffee grinder

These are ingredients for the base recipe. You can then add your own choice of fruits, which should mainly consist of berries. On this occasion we will use:

  • 12-15 medium to reasonably-sized strawberries

You can also use raspberries and blueberries too, or a mixture of these fruits.

Preparation

In a bowl put 2 tbsp of flax seed oil. Use a bowl that is deep to avoid the contents from flying out when you use the blender. To the oil add 4 tbsp of cottage cheese or quark. Next, use the hand-held blender and bring it in and out of the mixture to cause the mixture to become homogenous. In other words, all the oil should become mixed with the quark or cottage cheese and you should not see any oil left.

Next, grind the flax seeds (also called linseeds) in a coffee grinder and put them into the mixture. Mix well with a spoon until the ground flax seeds are well mixed in.

Next, you can cut up the strawberries into small to medium size chunks and add to the mixture.

Because the taste of the combination of the fat and oil may not be to your taste, you can add more fruit, and add a bit of honey to it as well. The great thing is you can experiment until you find the right combination of ingredients that you can then enjoy.

Visual Guide

Notes and Explanations

  • This recipe is very filling. It can serve as a meal on its own.

  • The reason for the quark or cottage cheese is that it contains proteins made of certain types of amino acids that bind to the fatty acids, to make them water soluble. On their own, fatty acids are not soluble in water. So by mixing them with the protein, we make them water soluble and hence more efficiently digested.

  • You may find that you get different textures with different brands of cottage cheese or with quark. Quark tends to be more thick and sticky whereas the cottage cheese is generally lighter. You can experiment and see whether quark or cottage cheese is more preferred, or which particular brand of cottage cheese is better for you.

  • This recipe will improve brain and nerve functioning alongside many other enhancements at the biochemical level. This is a result of the omega-3 fatty acids. This is a nice way to take plenty of omega-3 fatty acids in your diet.

  • omega-3 fatty acids lead to the body being "well-lubricated" so to speak. Essential fats are governing substances in all vital bodily functions. Imagine a car engine with a very low amount of oil in it. It won't be lubricated and it will cause the engine to become wrecked. That's a nice analogy for your body.

  • Your brain's dry weight is made of 60% fat, and it needs essential fatty acids to function properly. After taking this recipe twice a day for just a few days, we noticed an immense difference in levels of concentration.

  • Only grind the flax seeds at the point when you use them in the recipe. This is because in just 10-15 minutes the goodness starts to disappear by way of the fats becoming rancid. Never buy already ground flax seeds. Always grind them fresh.

  • You can also add some black seed oil (about half a teaspoon) if you wish to the oil at the very beginning. You can also add some Vitamin C powder as well (about half a level teaspoon) as that facilitates the use of omega-3 fatty acids in the body.

  • You are free to experiment with what you want to add to the base mixture. You can use any combination of raspberries, blueberries, grapes, a bit of honey, walnuts and so on. These fruits are used because they are high in antioxidants.

  • We try to take at least two servings of flax seed (omega-3 fatty acids) in the form of the flax seed porridge and this recipe on a daily basis.

There is a lot more that can be said here but we will expand upon the topic of flax seeds, the Budwig Protocol and omega-3 fatty acids in future articles.

Further Exploration and Reading

For those who are interested, these are the books we have (all translated from the German originals):

  • Flax oil As A True Aid Against arthritis, heart Infarction, cancer And Other Diseases, Dr. Johanna Budwig, apple Publishing Company (Canada)
  • Cancer, the Problem and the Solution, Dr. Johanna Budwig, with a foreword by Lothar Hirneise, Nexus Books, Germany
  • The Oil-Protein diet Cookbook, Dr. Johanna Budwig, apple Publishing (Canada) - this book contains hundreds of variations of the core recipe, and illustrates many ways you can include flax seed and flax oil into your diet.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use