Thursday, 23 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
10 Reasons to Avoid Refined Sugar
Posted by SoundHealth, in Nutrition
Topics: Sugar Sucrose Fructose Glucose Obesity Digestion Adrenalin Mental Health Brain Bone Health Tooth Decay Carbohydrates

  Mail To Friend    Printer Friendly Bookmark and Share

Sugar comes in many forms. fructose and glucose are monosaccharides, known as simple sugars. Glucose is the primary sugar in the blood, and fructose is the primary sugar in fruit and high fructose corn syrup. The simple sugars can combine to form more complex sugars, like the disaccharide sucrose (table sugar), which is half glucose and half fructose. Other forms of sugar are maltose (malt sugar) and lactose (milk sugar). Chemical terms ending in -ose indicate a sugar.

However, all sugars are not equal. The main difference between them is how your body metabolizes them. Glucose is the form of energy that our bodies run on - it is a simple, usable form of sugar. However, we are now consuming more and more sucrose and fructose in massive quantities, which is the primary cause for rising obesity levels, diabetes, a factor in the development of other chronic diseases, and is damaging to health in general.

Here are 10 reasons to cut down on, or avoid completely this harmful substance:

  1. Most concentrated forms of sugar (white sugar, brown sugar, malt, syrup) are devoid of vitamins and minerals, unlike natural sources such as fruit. White sugar has around 90% of its vitamins and minerals removed. Without vitamins and minerals, our metabolism becomes inefficient, contributing to poor energy levels, concentration and weight control.

  2. Sugar actually uses up the body's stores of vitamins and minerals whilst providing next to none. Each teaspoon of sugar uses up B vitamins, for example, which can result in a deficiency. B vitamins are vitamin for maximizing mental performance. Around 98 % of the chromium present in sugar cane is lost turning it into sugar. This mineral is vital for keeping blood sugar levels stable.

  3. Sugar, in its concentrated, refined form, cannot be digested. It inactivates digestive enzymes and remains in the tract, fermenting and causing the blood to become acidic. One effect of an over-acidic digestive tract is that the good bacteria in the intestine are destroyed. These are required in the final stages of digestion and without them, rotting and stagnation of food is promoted, instead of digestion. The half-digested carbohydrates leak into the bloodstream and cause problems in the joints, muscles and organs, and have been linked to diseases such as osteoarthritis, kidney disease, irritable bowel syndrome, candida, reflux/heartburn and chronic allergies.

  4. An excess of sugar sends adrenalin, the stress hormone, sky high. In a study from Yale University, 25 children were given a drink containing the amount of sugar found in a can of a popular soft drink. The rebound sugar drop - when too much sugar in the blood causes insulin to overcompensate by taking too much sugar out - boosted their adrenalin to over five times their normal level. Most of the children had difficulty concentrating and were irritable and anxious, which are normal reactions to too much adrenalin in the bloodstream. Jones TW, Borg WP, Boulware SD, McCarthy G, Sherwin RS, Tamborlane WV. Enhanced adrenomedullary response and increased susceptibility to neuroglycopenia: mechanisms underlying the adverse effects of sugar ingestion in healthy children. J Pediatr. 1995 Feb;126(2):171-7.

  5. Conclusive evidence has found that high sugar consumption is linked to poor mental health. Research has found that the higher the intake of refined carbohydrates, the lower the IQ. If fact, the difference between high sugar consumers and low sugar consumers was a staggering 25 points.

  6. Sugar is also implicated in aggressive behavior, anxiety, hyperactivity and attention deficit, depression, eating disorders, fatigue, learning difficulties and premenstrual syndrome.

  7. Glucose damages the brain. Glucose itself is not toxic, but when blood sugar levels go above the maximum threshold, which it what happens in severe diabetes (dysglycaemia), glucose becomes toxic to the brain. This is why diabetics develop nerve, eye and brain damage. An excess of glucose, much like oxidants, damage nerve cells and stop them working properly. This reaction, called glycation, causes the proteins in the brain and nervous system to react, slowing down brain communication, and causing inflammation in the brain.

  8. The body can become "sensitized" to sugar. The more sugar is consumed, the more effective the body is in absorbing it; and the more that is absorbed, the more damage it will do. This is because sugar activates its own metabolic pathways in the body, which become "upregulated", or increased in sensitivity to sugar.

    The good news is that even a short break from sugar will cause sugar sensitization to rapidly decrease and "downregulate" those metabolic pathways. Research indicates that even two weeks without consuming sugar will cause your body to be less reactive to it.

  9. Sugar is the cause of bone loss and dental decay. It causes an increase in calcium levels and a drop in phosphorus levels, because calcium is pulled from the teeth and bones. This drop in phosphorus hinders the absorption of calcium, making it unstable and therefore toxic. Thus, sugar consumption causes tooth decay not because it promotes bacterial growth in the mouth, but because it alters the internal body chemistry.

  10. Other refined carbohydrates such as white bread, white rice and processed cereals have an effect similar to that of refined sugar. The process of refining or even cooking starts to break down complex carbohydrates into simple carbohydrates, in effect predigesting them. When eaten, they produce a rapid increase in blood sugar level and a corresponding surge in energy. The surge, however, is followed by a drop as the body scrambles to balance blood sugar levels.

Here is the link for an excellent video by Dr Robert Lustig, on the damage caused by sugary foods (please note, there is a musical introduction for a minute at the beginning and around 40 seconds at the end):

http://www.youtube.com/watch?v=dBnniua6-oM

Robert H. Lustig, MD, UCSF Professor of Pediatrics in the Division of Endocrinology, explores the damage caused by sugary foods. He argues that fructose (too much) and fiber (not enough) appear to be cornerstones of the obesity epidemic through their effects on insulin. Series: UCSF Mini Medical School for the Public [7/2009] [Health and Medicine] [Show ID: 16717]


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use