Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home News
Fruits and Vegetables Shown to Reduce Risk of Breast Cancer
Posted by SoundHealth, in News
Topics: Fruit Vegetables Breast Cancer

  Mail To Friend    Printer Friendly Bookmark and Share

Here is further evidence that eating a diet rich in fruits and vegetables drastically reduces the risk of developing breast cancer, or of preventing a reoccurrence. Scientists from China have just released research findings that add to the growing pile of evidence that eating whole, natural food is an effective way of keeping away this disease.

Study Details

Abstract

The effect of vegetable and fruit consumption on breast cancer risk is controversial. We examined the association between vegetable and fruit intake and breast cancer risk in a hospital-based case-control study conducted in Guangdong, China. Four hundred and thirty-eight cases were frequency matched to 438 controls by age (5-year interval) and residence (rural/urban). Dietary intake was assessed by face-to-face interviews using a validated food frequency questionnaire. Multivariate logistic regression was used to estimate the odds ratios (ORs) and 95% confidence interval (CI) after adjusting for various potential confounders. Total vegetable and fruit intake was found to be inversely associated with breast cancer risk. The ORs of the highest quartile relative to the lowest quartile of total vegetable and fruit intake were 0.28 (95% CI 0.18-0.43) and 0.53 (95% CI 0.34-0.82), respectively. Consumption of individual vegetable and fruit groups such as dark green leafy vegetables, cruciferous vegetables, carrots and tomatoes, banana, watermelon/papaya/cantaloupe were all inversely and significantly related with breast cancer risk. An inverse association was also observed for Vitamin A, carotene, Vitamin C, Vitamin E, and fiber intake. These data indicate that greater intake of vegetables and fruits is associated with a decreased risk of breast cancer among Chinese women residing in Guangdong.

Research paper details:

Zhang CX, et al. Greater vegetable and fruit intake is associated with a lower risk of breast cancer among Chinese women. International journal of cancer. 2009-Jul; vol 125 (issue 1) : pp 181-8.

Basically, this study found that those eating the lowest amounts of fruits and vegetables had a 47 percent increased risk of breast cancer. Consumption of vegetable and fruit groups such as dark green leafy vegetables, cruciferous vegetables, carrots, tomatoes, bananas, watermelon, papaya, and cantaloupe showed a significant reduction related to breast cancer risk. This was also the same for intake of the vitamins A, C, E, carotene, and fiber.

In a previous study, it was found that fruits and vegetables can reduce breast cancer recurrence by 40 percent. The 2005 study examined the relationship between plasma carotenoid concentration as a biomarker of fruit and vegetable intake, and the risk for a new breast cancer event in 1,550 women previously treated for early stage breast cancer. After 5 years of follow-up, those women with the highest plasma carotenoid concentrations had a 40 percent reduced risk for breast cancer recurrence.

Research paper details:

Rock, CL, et al. Plasma carotenoids and Recurrence-Free Survival in Women With a History of breast cancer. Journal of Clinical Oncology, Vol 23, No 27 (September 20), 2005: pp. 6631-6638.

carotenoids are natural fat-soluble pigments found in certain plants, and are responsible for the bright red, orange and yellow in fruits and vegetables. The most well-known carotenoids are: carotene which is found in carrots, spinach, kale and cantaloupe; lycopene which is high in tomatoes, pink grapefruit, watermelon, papaya, and apricots; and lutein, found in dark green leafy vegetables and blueberries.

Summary

Almost all fruits and vegetables contain health-beneficial properties and have anti-cancer activity. Some in particular that have been well researched are cruciferous vegetables (broccoli, cabbage, kale, Brussels sprouts), umbelliferous vegetables (carrots, celery, parsnips, coriander, parsley), tomatoes, peppers, onions and garlic. Other articles on this site give the specific health benefits of each of these fruits and vegetables, and many others. Aim to eat a range of different fruits and vegetables regularly; in fact a large proportion of your diet should consist of fruits and vegetables.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use