Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Spinach: Health Benefits of this Green Vegetable
Posted by SoundHealth, in Nutrition
Topics: Spinach

  Mail To Friend    Printer Friendly Bookmark and Share

Spinach, like all dark green vegetables, is packed full of beneficial nutrients. Although well known for being an excellent source of iron and folic acid, spinach also contains many protective carotenoids, beneficial for healthy eyesight and other eye-related conditions, as well as having anti-carcinogenic properties.

Spinach belongs to the same family as beets and chard. The three main types of spinach are smooth leaf, savoy (this has wrinkled, curly leaves) and semi savoy (a hybrid between the two types). All are rich in nutrients, especially baby spinach leaves, which have 90 percent more antioxidants that an iceberg lettuce.

This vegetable is an excellent source of fiber, vitamin K and Vitamin C. It is a rich source of minerals such as calcium, iron, magnesium and manganese. It is also a good source of folate, a water-soluble B vitamin which is important for good cognitive function. Spinach is especially high in carotenoids, which the body converts to the antioxidant Vitamin A to help trigger immune response to fight infections. These carotenoids, including Beta-carotene, zeaxanthin, and lutein also act as protection for eye-related conditions like macular degeneration. Spinach is one of the richest sources of lutein, and is also rich in glycolipids, powerful phytochemicals known to have cancer cell growth suppression qualities.

Health Benefits

Researchers have identified at least 13 different flavonoid compounds in spinach that function as antioxidants and as anti-cancer agents. The anticancer properties of these spinach flavonoids have been sufficiently impressive to prompt researchers to create specialized spinach extracts that have been used in controlled studies. Here is a selection of some of the findings.

age-related macular degeneration

A study involving 356 subjects with advanced macular degeneration (vision loss) found that higher intake of spinach resulted in significantly lower risk for age-related macular degeneration.

cancer

A study of human liver cancer cells found that spinach had the highest antiproliferative effect (inhibited cell growth) as compared to other vegetables.

Another study found a significant relationship between spinach consumption and the risk of gallbladder cancer.

A natural antioxidant in spinach leaves was found to slow prostate cancer in both animal and human prostate cancer cells.

Retinoids in spinach were found to have chemotherapeutic and chemopreventative potential for cervical cancer.

cataracts

A study of more than 36.000 Americans found that spinach was correlated with a lower risk of developing cataracts.

Neuroprotective

Rats that had suffered brain damage and were fed a spinach diet showed a reduction in damaged tissue and increased brain function.

Tips for Using Spinach

  • Store fresh spinach in the refrigerator, as it will retain more nutrients this way. A 2005 study found that commercially packed fresh spinach stored at refrigerator temperatures retained folate and carotenoid content at a slower rate than spinach stored at higher temperatures, but when it was kept for longer than 8 days it lost much of its nutrient content.

  • Spinach is extremely versatile. The baby leaves can be eaten raw in salads, or it can be wilted for a few minutes in butter, olive oil or lemon juice, to accompany any dish.

References

  • Moeller, S.M., Jacques, P.F., & Blumberg, J.B. (2000, October). The potential role of dietary xanthophylls in cataract and age-related macular degeneration. J Am Coll Nutr, (5 Suppl): 522S-527S.

  • Kuriyama, I., Musumi, K., Yonezawa, Y., Takemura, M., Maeda, N., Iijima, H., Hada, T., Yoshida, H., & Mizushina, Y. (2005, October). Inhibitory effects of glycolipids fraction from spinach on mammalian DNA polymerase activity and human cancer cell proliferation. Journal of Nutritional Biochemistry, 16(10), 594-601.

  • Seddon, J.M., Ajani, U.A., Sperduto, R.D., Hiller, R., Blair, N., Burton, T.C., Farber, M.D., Gragoudas, E.X., Haller, J., & Miller, D.T. (1994, November 9). Dietary carotenoids, vitamins A,C, and E, and advanced age-related macular degeneration. Eye disease case-control study group. JAMA, 272(18), 1413-1420.

  • Chu, Y.F., sun, J., Wu, X., & Liu, R.H. (2002, November 6). Antioxidant and antiproliferative activities of common vegetables. J Agric Food Chem, 50(23), 6910-6.

  • Rai, A., Mohapatra, S.C. & Shukla, H.S. (2006, April). Correlates between vegetable consumption and gallbladder cancer. Eur J cancer Prev, 15(2), 134-137.

  • Sani, H.A., Rahmat, A., Ismail, M., Rosli, R., & Endrini, S. (2004). Potential anticancer effect of red spinach (Amaranthus gangeticus) extract. Asia Pacific Journal of Clinical nutrition, 13(4), 396-400.

  • Nyska, A., Suttie, A., Bakshi, S., Lomnitskia, L., Grossman, S., Bergman, M., Ben-Shaul, V., Crocket, P., Haseman, J.K., Moser, G., Goldsworthy, T.L., & Maronpot, R.R. (2003, January/February). Slowing Tumorigenic Progression in TRAMP Mice and Prostatic Carcinoma Cell Lines Using Natural Anti-Oxidant from spinach, NAO--A Comparative Study of Three Anti-Oxidants. Toxicologic Pathology, 31(1), 39-51.

  • Abu, J., Batuwangala, M., Herbert, K., & Symonds, P. (2005, September). Retinoic acid and retinoid receptors: potential chemopreventive and therapeutic role in cervical cancer. Lancet Oncol, 6(9), 712-720.

  • Brown, L., Rimm, E.B., Seddon, J.M., Giovannucci, E.L, Chasan-Taber, L., Spiegelman, D., Willett, W.C., & Hankinson, S.E. (1999, October). A prospective study of carotenoid intake and risk of cataract extraction in US men. Am J Clin Nutr, 70(4), 431-432.

  • Wang, Y., Chang, C., Chou, J., Chen, H., Deng, X., Harvey, B., Cadet, J.L., Bickford, P.C. (2005, May). Dietary supplementation with blueberries, spinach, or spirulina reduces ischemic brain damage. Experimental Neurology, 193(1), 75-84.

  • Kelemen et al. vegetables, fruit, and antioxidant-related nutrients and risk of non-Hodgkin lymphoma: a National cancer Institute-Surveillance, Epidemiology, and End Results population-based case-control study. Am J Clin Nutr. 2006 Jun;83(6):1401-10.

  • Pandrangi S, Laborde LF. Retention of folate, carotenoids, and other quality characteristics in commercially packaged fresh spinach. Journal of Food Science, Vol. 69, No. 9, 2004.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use