Thursday, 23 February 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Vitamin K Is Essential for Blood Clotting, Healing and Bone Health
Posted by SoundHealth, in Nutrition
Topics: Vitamin K Heart Bones Diabetes Blood Cancer

  Mail To Friend    Printer Friendly Bookmark and Share

This little known, but important nutrient has many important functions in the body. Vitamin K is essential for the production of blood clotting proteins, it helps wounds to heal properly, and plays important roles in bone metabolism and heart health. Evidence also suggests that increased levels of vitamin K2 are associated with a reduced risk of prostate cancer.

Vitamin K is a fat-soluble vitamin, so it is stored in fatty tissue in the body. Three types of compound have vitamin K activity: K1, K2 and K3. Most of our dietary intake is in the form of vitamin K1, from vegetables such as broccoli and cauliflower. However, we obtain only very small amounts of the most useful form, vitamin K2, which is found, for example in probiotic foods.

Health Benefits

Some vitamin K2 is made naturally by probiotic bacteria in the bowel. Absorption is not that efficient, however, and the amounts made are not enough to need our needs. Production appears to be reduced in older people and in those taking antibiotics.

  • Bones: vitamin K is needed to make the protein, osteocalcin, which binds calcium in your bones. Lack of vitamin K is linked to osteoporosis and research suggests vitamin K supplements can reduce calcium loss from bones in older women by up to 50%, and helps to strengthen weak bones and reduce the risk of fractures. [1]

  • Diabetes: some evidence suggests that vitamin K is associated with reducing thee development of insulin resistance and protects against type-2 diabetes. This could be linked with the vitamin K-dependant bone protein, osteocalcin, which is thought to play a role in glucose metabolism.

  • Heart: vitamin K2 (but not vitamin K1) is associated with reducing the risk of heart disease in older people, especially older women. Researchers looking at dietary intakes of over 16,000 women aged 49-70 years found that every 10mcg increase in dietary intakes of vitamin K2 reduced the risk of coronary heart disease by 9%. [2] This may be related to a reduced build-up of calcification in artery walls.

  • Cancer: Evidence is also emerging that links vitamin K as a powerful player in cancer prevention. Recent studies have connected vitamin K2 with a nearly 30 percent reduction in the risk of cancer mortality and a 14 percent lowered risk of cancer altogether, and high dietary vitamin K intakes with up to 45 percent lower risk of developing cancer of the immune system.

Good Sources

Good sources of vitamin K1 include green leafy vegetables such as broccoli, cabbage, cauliflower, spinach, and vegetable oils and cereals. Fermented foods like sauerkraut, cheese and other probiotic foods are good sources of vitamin K2.

Try to include both vitamin K1 and K2 in the diet for better overall health.

To obtain the heart and circulatory benefits of this vitamin, look for supplements that contain vitamin K2 rather than vitamin K1 where possible, but not vitamin K3, or menadione, which is a synthetic, man-made form of the vitamin.

References

[1] Cockayne S, et al. Vitamin K and the prevention of fractures: systematic review and meta-analysis of randomized controlled trials. Arch Intern Med 2006; 166(12):1256-61.

[2] Gast GC, et al. A high menaquinone intake reduces the incidence of coronary heart disease.Nutr Metab Cardiovasc Dis 2009;19(7):504-10.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use