Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Prophetic Medicine
Ibn al-Qayyim: Fresh Water Fish Is More Beneficial
Posted by SoundHealth, in Prophetic Medicine
Topics: Fish Salmon

  Mail To Friend    Printer Friendly Bookmark and Share

Ibn al-Qayyim mentioned the benefits of eating fish in his Prophetic Medicine. He said that the best fish was that with a pleasing taste, good-smelling, of moderate size, and with thin skin, consisting of neither hard nor dry flesh. He also gave preference to those which lived in fresh water, and fed on plants, not on anything polluted.

Ibn al-Qayyim said that sea fish was excellent; as it made the body fertile and that the best portion of a fish was that close to the rear of it.

salmon

Salmon is classed as a freshwater fish that belongs to the Salmonidae family, which also includes trout. Although salmon generally live in oceans and lakes throughout the world, they do return to freshwater to reproduce. The majority of Atlantic salmon available on the market are typically farmed, while the majority of Pacific salmon are caught in the wild. Farmed salmon is the most popular salmon consumed in Europe and the US.

Health Benefits of Eating Salmon

Salmon is a rich source of omega-3 fatty acids, which are necessary for proper brain functioning and a healthy cardiovascular system. The flesh is usually orange or red due to the carotenoids found there. Salmon also contains important minerals including calcium, phosphorus, potassium, iron, magnesium, selenium and zinc.

Studies suggest that the inclusion of fatty fish, such as salmon, along with fruits, vegetables, whole grains, nuts and seed, reduces the risk of cancer, heart attack, stroke and diabetes. The omega-3 fats found in salmon have also shown to benefit heart health, depression, asthma and cancer.

Beware of Contaminants in Fish

Fish should be eaten in moderation because nearly all fish and shellfish contain harmful chemicals. The five primary contaminants are mercury, polychlorinated biphenyls (PCBs), chlordane, dioxins, and DDT. Numerous studies have linked these substances to health problems in adults and unborn children.

To minimize the risks, try to find out exactly where your fish comes from and eat fish known to have low levels of contaminants, such as Alaska-caught fish. Also, a high percentage of contaminants collect in the fatty portion of the fish, and in the area between the flesh and skin (in some species this area has darker flesh). Therefore it is advisable to trim away any fat from the back, belly and lateral line. Cooking the fish and allowing the fat to drain away may also reduce possible contaminants.

Tips on Eating Fish

  • Try to eat wild salmon as much as possible, as several studies have found concentrations of PCBs and other contaminants at levels of up to 10 times higher in farmed salmon compared to wild salmon.

  • Fresh, wild-caught salmon are only available for a few months of the year. Farm-raised salmon are available all year round.

  • Fresh fish should either be eaten or frozen within two days of purchase.

  • Common herbs that complement fish include dill and rosemary.

References

  • Harris WS, Isley WL. Clinical trial evidence for the cardioprotective effects of omega-3 acids. Curr Atheroscler Rep. 2001; 3(2): 174-179.

  • Jho DH, Cole SM, Lee EM, Espat NJ. Role of omega-3 fatty acid supplementation in inflammation and malignancy. Integr cancer Ther. 2004 Jun;3(2):98-111.

  • Kris-Etherton P, Harris WS, Appel Q. Fish consumption, fish oil, omega-3 fatty acids, and cardiovascular disease. Am HeartAssoc Sci Statement. 2002; 2747-2757.

  • Marchioli R, Barzi F, Bomba E, et al. Early protection against sudden death by n-3 polyunsaturated fatty acids after myocardial infarction. Circulation. 2002;105: 1897-1903.

  • Singh RB, et al. Effect of an Indo-Mediterranean diet on progression of coronary artery disease in high risk patients. Lancet. 2002; 360:1455-1461.

  • Burette ME, Koumenis IL, Edens MB, Tramposch KM, Clayton B, Bowton D, Chilton FH. Inhibition of leukotriene biosynthesis by a novel dietary fatty acid formulation in patients with atopic asthma: a randomized, placebo-controlled, parallel-group, prospective trial. Clin Ther Mar. 2003; 25(3):972-979.

  • Suzuki S et al. Daily omega-3 fatty acid intake and depression in Japanese patients with newly diagnosed lung cancer. Br I cancer. 2004 Feb;23:90(4):787-793. Von Schacky C, Angerer P, Kothny W, Thiesen K, Mudra H. The effect of dietary n-3 fatty acids on coronary atherosclerosis. Ann Intern Med. 1999; 130: 554-562.

  • Steuerwald U, Weihe P, Jorgensen PJ, et al. Maternal seafood diet, methylmercury exposure, and neonatal neurologic function. J Pediatr. 2000:136(5);599605.

  • Murata K, Weihe P, Budtz-Jorgensen E, Jorgensen PJ, Grandjean P. Delayed brainstem auditory evoked potential latencies in 14-year-old children exposed to methylmercury. J Pediatr. 2004:144;177-83.

  • Mahaffey KR, Clickner RP, Bodurow CC. Blood organic mercury and dietary mercury intake: national health and nutrition examination survey, 1999 and 2000. Environ HealthPerspect. 2004;112(5):562-70.

  • Jones RL, Sinks T, Schober SE, Pickett M. Blood mercury levels in young children and childbearing-aged women United States, 1999-2002. MMWR. 2004;53(43):1018-20.

  • Centers for disease Control. CDC's Third National Report on Human Exposure to Environmental Chemicals. Results by chemical group. July 2005.

  • DeVoogt P, Brinkman UAT. Production, properties and usage of polychlorinated biphenyls. In: Kimbrough RD, Jensen A (eds). Halogenated Biphenyls, Terphenyls, Naphthalenes, Dibenzodioxins and Related Products. 2nd ed. Amsterdam: Elsevier, 1989:346.

  • Carpenter DO. Contaminants in farmed salmon from around the world. Available at the Environmental Protection Agency website.

  • Mozaffarian D, Rimm EB. Fish intake, contaminants, and human health. Evaluating the risks and the benefits. JAMA. 2006;296(15):1885-99.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use