Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Mind
Five Brain-Drainers
Posted by SoundHealth, in Mind
Topics: Brain Oxidants Trans Fat Sugar Stimulants Stress Caffeine Toxic Chemicals

  Mail To Friend    Printer Friendly Bookmark and Share

Optimizing your brain function is not only about getting the right nutrients. It's also important to minimize the nutrients that can pollute the brain and potentially damage and age it.

Here are five 'anti-nutrients' for the memory that you should avoid.

oxidants

The dry matter of the brain is made up of 60 per cent fat, and therefore the kind of fat you eat alters the kind of fat in your brain. The worst fats you can eat are called 'trans' fats, which are damaged fats found in deep fried food and foods containing hydrogenated vegetable oils. Therefore avoid these fats by limiting your intake of fried food, and don't buy foods containing hydrogenated fats.

Why are trans fats so bad for you?

Trans fats are one of the main factors that introduce oxidants into the body, other factors are smoking and pollution. These fats are taken directly into the brain after being eaten, and cause a chain reaction of damage to the essential fats attached to phospholipids in nerve cell membranes. They also block the conversion of essential fats into vital brain fats. As the brain is more than half made up of fat, there is a danger of these fats becoming oxidized or going rancid.

The good news is that Vitamin E can protect your brain from these damaging effects. Vitamin E is a fat-based antioxidant and many studies have shown that it is consistently associated with better memory performance. [1,2]

Vitamin E is properly called 'd-alpha tocopherol', and is present in foods like seeds, cold-pressed seed oils and fish.

sugar

Eating lots of sugary foods and refined carbohydrates makes it difficult to maintain even blood sugar levels.

Another reason sugar is bad for you is that it uses up your body's stores of vitamins and minerals and provides next to none in return.

Conclusive evidence has shown that high sugar consumption is linked to poor mental health. Researchers have found that the higher the intake of refined carbohydrates, the lower the IQ. [3]

Sugar has also been implicated in depression [4], learning difficulties [5], aggressive behavior [6] and anxiety [7].

So the message is clear, if you want to optimize your mental performance, cut back on sugar and refined carbohydrates.

stimulants

Blood sugar problems can also be affected by excessive intake of stimulants. When blood sugar levels dips, one way to raise them is to eat more glucose; the other is to raise your levels of the stress hormones adrenalin and cortisol. Consuming a stimulant like tea, coffee or chocolate is one way to do this.

Studies have shown that coffee is not only addictive, it also worsens mental performance. One study showed that moderate and high consumers of coffee (more than 1 cup a day) had higher levels of depression, anxiety, and other medical problems, as well as lower academic performance, than abstainers. [8]

Caffeine blocks receptor to the brain whose job it is to stop the release of the neurotransmitters dopamine and adrenalin. This causes the levels of these hormones to increase, as do alertness and motivation. The more caffeine is consumed, the more the body and brain become insensitive to their own natural stimulants, dopamine and adrenalin, and therefore need more of these to feel normal, pushing the body to produce more and more, eventually causing adrenal exhaustion.

If you want to stay in top mental health, restrict your intake of stimulants, including coffee, tea, cola, energy drinks and chocolate. The occasional cup of tea or coffee is unlikely to cause a problem and may even be beneficial due to the high polyphenol content, which acts as an antioxidant.

stress

Stress increases levels of the hormone cortisol, and cortisol damages the brain. According to research conducted at Stanford University, two weeks of raised cortisol levels caused by stress causes the connections between brain cells to shrivel up. [9]

Numerous other studies have shown that elevated cortisol levels are linked to impaired memory function [10]. However, another study found that that high levels of another stress hormone, DHEA, contributed to improved memory. [11]

This adrenal hormone, dehydroepiandrosterone, or DHEA, not only helps to control stress, it also maintains proper mineral balance and builds lean body mass while reducing fat tissue. Levels of this hormone can be boosted with stress management through diet, exercise and lifestyle changes, as well as supplementation.

Prolonged stress also disturbs blood sugar balance, which can affect memory and alertness, as well as potentially damaging the brain, as explained earlier.

Toxic minerals

Potentially harmful chemicals are used everywhere, from the food we eat, to in our homes. Much of our fresh food is sprayed with pesticides and herbicides, and chemicals have made their way into our homes through cookware, fumes, our water supply and many other ways. These chemicals are sometimes classified as anti-nutrients- substances that interfere with either our ability to absorb essential nutrients, or promote the loss of nutrients from the body.

The full effects of toxic minerals on our mental health is not yet known, but studies have shown that high intakes of lead, aluminium, mercury, certain food colorings and other chemicals can have a disastrous effect on intellectual performance and behavior.

The good news is that certain substances, called chelators, can latch onto these toxic minerals when they have been absorbed by the body, and try to take them out. Vitamin C is especially effective at removing heavy metals in the blood. [12] Other useful vitamins are zinc, calcium and selenium. [13]

There are also some foods that can help to clear the brain of toxicity. Sulfur-containing amino-acids as found in garlic, onions and eggs can protect against mercury, cadmium and lead toxicity. The pectin from apples, carrots and citrus fruits can also help chelate and remove heavy metals.

References

  • [1] A.J. Perkins et al., 'Association of antioxidants with memory in a multiethnic elderly sample using the Third National health and nutrition Examination Survey', Am J Epidemiol, Vol 150(1), 1999, pp. 37-44

    [2] J. Perrig et al., 'The relation between antioxidants and memory performance in the old and very old', JAm Geriatr Soc, Vol 45(6), 1997, pp. 718-24

  • [3] A.G. Shauss, 'Nutrition and behavior', Journal of Applied nutrition, Vol 35(1), 198 pp. 30-35 and MIT Conference Proceedings on Research Strategies for Assessing the Behavioural Effects of Foods and Nutrients, 1982

  • [4] L. Christensen, 'Psychological distress and diet - effects of sucrose and caffeine', J Appl Nutr, Vol 40(1), 1988, pp. 44-50

  • [5] M. Colgan and L. Colgan, 'Do nutrient supplements and dietary changes affect lean and emotional reactions of children with learning difficulties? A controlled series cases', Nutr health, Vol 3, 1984, pp. 69-77

  • [6] D. Benton et al., 'Mild hypoglycaemia and questionnaire measures of aggression', Biol Psychol, Vol 14(1-2), 1982, pp. 129-35

  • [7] M. Bruce and M. Lader, 'Caffeine abstention and the management of anxiety disorders', Psychol Med, Vol 19, 1989, pp. 211-14

  • [8] K. Gilliland and D. Andress, 'Ad lib caffeine consumption, symptoms of caffeinism, and academic performance', American Journal of Psychiatry, Vol 138(4), 1981, pp. 512-4

  • [9] R.M. Sapolsky, 'Why stress is bad for your brain', Science, Vol 273(5276), 1996, pp. 749-50

  • [10] C. Kirschbaum et al., 'Stress- and treatment-induced elevations of cortisol levels associated with impaired declarative memory in healthy adults', Life Sci, Vol 58(17), 1996, pp. 147583

  • [11] LE Carlson et al., 'Relationships between dehydroepiandrosterone sulfate (DHEAS) and cortisol (CRT) plasma levels and everyday memory in Alzheimer's disease patients compared to healthy controls', Horm Behav 35(3), 1999, pp. 254-63

  • [12] R. Goyer and M.G. Cherian, 'Ascorbic acid and EDTA treatment of lead toxicity in rats', Life Sci, Vol 24(5), 1979, pp. 433-8

  • [13] E.J. O'Flaherty, 'Modeling normal aging bone loss, with consideration of bone loss in osteoporosis', Toxicol Sci, Vol 55(1), 2000, pp. 171-88


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use