Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Body
Aloe Vera: A Natural Cure For Cancer, Diabetes, Inflammation and Much More
Posted by SoundHealth, in Body
Topics: Aloe Vera Cancer Inflammation Immune System Skin Arthritis Burns

  Mail To Friend    Printer Friendly Bookmark and Share

Aloe vera is an impressive plant with an amazing variety of healing benefits. In a single plant, aloe vera offers a potent, natural cure for many internal and external conditions and its medicinal potential makes it a must-have plant for every home.

The gel found inside the aloe vera plant is made up of water, 20 minerals, 12 vitamins, 18 amino acids and 200 active plant compounds or phytonutrients, which are responsible for the plant's remarkable healing properties.

The use of aloe vera topically, to relieve sunburn or painful joints, for example is well known. However, this versatile plant has also been shown to:

Aloe Vera Reduces inflammation and Boosts the immune system

Aloe has been found to ease the inflammation of joints, including reducing arthritis pain, when used both topically and internally. One study found that people who drank aloe vera for two weeks began to experience a significant reduction of inflammation symptoms.

Aloe vera contains acemannan, a natural immune booster. Studies have also shown that when aloe is taken internally it can stimulate and regulate the immune system by stopping inflammation and cutting off the blood supply of tumors.

Aloe vera also amplifies the antioxidant effects of vitamins. It makes Vitamin C, Vitamin E and other antioxidants work better, probably due to its effect on enhancing blood quality and allowing the blood to more effectively transport oxygen and nutrients to the body's cells.

Aloe Vera Destroys cancer

Research into the anti-cancer effects of acemannan, a phytonutrient found in aloe vera, found promising results. In one study, dogs and cats undergoing radiation for cancer were given acemannan. Not only did the tumors shrink more in the acemannan-treated group, but post-treatment survival was significantly extended.

Another study demonstrated that acemannan increased cells' production of nitric oxide (NO), an anti-cancer chemical strongly associated with the shrinking of cancer tumors.

Although this particular research was focused on chickens, the same effect has also been observed in humans.

In other studies, aloe vera showed a marked result in producing remission in skin cancers. Its highly effective antioxidant effect has also been found to help prevent skin damage from x-rays and other forms of radiation.

Aloe Vera Stabilizes blood sugar Levels

Diabetic patients who took aloe vera for 3 months experienced a significant drop in fasting blood sugar levels. They also had lower cholesterol levels and slight improvements in total cholesterol. Numerous clinical studies have been published that demonstrate aloe vera's anti-diabetic properties.

Aloe Vera Heals burns, Cuts and Scrapes

Aloe vera is nature's first aid kit. It is antibacterial, antiviral and antifungal, making it extremely effective in wound care. Placed directly on or in the wound, aloe vera gel kills bacteria, prevents infection and actually nourishes the damaged tissues while sealing the wound against infection.

Aloe has been known to heal third-degree burn victims with no scarring and to restore burned skin that would have normally died.

Studies confirmed that wounds treated with aloe heal far faster than other wounds not so treated - both for traumatic as well as surgical wounds.

The juice is also effective for the treatment of minor wounds and insect bites by forming a "natural plaster" over the wound.

Aloe Vera Extends lifespan

A study on rats showed that aloe vera extended lifespan by 10 percent. The study also found that the rats had a less incidence of blood clots in the heart, less kidney disorders, a slightly lower incidence of fatal leukemia and fewer causes of death compared to the control group. Also, no adverse, toxic effects were found with the ingestion of aloe vera.

Aloe Vera Enhances skin health

Aloe is one of the most widely-used ingredients in skin care products. This is because it is great for the skin. Aloe soothes the skin, hydrates it, nourishes it and accelerates the regeneration of new skin tissue. It also enhances skin health when used internally, such as when added to juices.

Externally, aloe vera gel can be applied directly to the skin as a softening agent and used for the treatment of:

  • skin irritation
  • burns and scalds
  • sunburn
  • wounds
  • eczema
  • psoriasis
  • acne
  • dermatitis
  • ulcers

This is just a selection of the conditions that aloe vera is known to improve or cure. For more information or for further studies, search on Google Scholar.

How to Use aloe vera

Aloe vera plants are easy to care for. They need bright light and water every two weeks to grow and stay healthy, so keep your plant on a sunny windowsill.

Aloe vera is most effective when used fresh so use it as soon as it is removed from the plant.

The gel found inside the aloe vera leaf contains its health benefits. To extract this gel, cut off a large leaf from the plant. Either strip away the green leaf from around the gel using a knife, or squeeze the gel out. The plant will heal up around the cut leaf, and will not become infected, due to aloe's anti-bacterial properties.

Apply this cool, soothing gel directly onto the skin, or use it internally by adding it to fresh juices.

References

  • GK King, KM Yates, PG Greenlee, et al.The effect of Acemannan Immunostimulant in combination with surgery and radiation therapy on spontaneous canine and feline fibrosarcomas. Journal of the American Animal Hospital Association, Vol 31, Issue 5, 439-447.

  • Karaca K, Sharma JM, Nordgren R. Nitric oxide production by chicken macrophages activated by Acemannan, a complex carbohydrate extracted from aloe vera. Int J Immunopharmacol. 1995 Mar;17(3):183-8.

  • Yu BP, Herlihy J, Ikeno Y. The Effects of Lifelong aloe Ingestion on aging and Pathology. Department of Physiology.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use