Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Ten of the Most Powerful Healing Herbs and Spices
Posted by SoundHealth, in Nutrition
Topics: Herbs Spices Cinnamon Turmeric Basil Clove Cumin Fennel Mint Oregano Parsley Fenugreek

  Mail To Friend    Printer Friendly Bookmark and Share

Some of the most powerful healers can be found in the kitchen - herbs and spices. These wonderfully fragrant and flavor-enhancing additions to food also contain a wealth of natural healing properties that have a number of diverse benefits, from aiding digestion to reducing the risk of cancer.

All herbs and spices contain substances that promote healing, and here are just ten of the most powerful ones, and some reasons why you should be using them in cooking and as health-enhancers:

  • 1. Cinnamon - cinnamon bark contains an oil-like substance that kills a variety of illness causing bacteria, including E.coli and Salmonella, and research shows that cinnamon is able to stop the growth of the Asian flu virus. Cinnamon has a surprisingly strong effect on the brain and mood; its distinctive smell helps to reduce anxiety and stress, increase alertness, and prevent mood swings caused by fluctuating blood-sugar levels.

  • 2. Turmeric - turmeric contains curcumin, a powerful antioxidant chemical that detoxifies carcinogens and calms inflammation, making it useful for easing auto-immune conditions such as rheumatoid arthritis and allergies. It appears to work just like non-steroidal anti-inflammatory drugs, without the side effects. Turmeric is such as strong anti-inflammatory that only a small amount is enough to reduce the risk of illness.

    Curcumin, which gives this spice its vivid golden color, also helps to prevent the build up of fatty deposits in the arteries, and so may protect against conditions such as Alzheimer's and heart disease.

  • 3. Basil - basil contains volatile oils, which account for the medicinal properties of this herb. It relieves flatulence, is an aid to digestion and its antiseptic properties are said to benefit acne. This fragrant oil also has antimicrobial effects. Recent tests have found that basil oils can counteract the growth of antibiotic-resistant superbugs, including those that cause food poisoning and others that infect wounds.

  • 4. Clove - clove oil is 60 to 90 percent eugenol, a potent pain-relieving compound, effective for numbing the pain toothache, headaches, and other areas of pain, such as the joints. As well as their anaesthetic effects, cloves combat the bacterial infection and inflammation that can lead to gum disease and the risk of further damage to teeth.

  • 5. Cumin - cumin seeds are valued for their digestive benefits. Cumin relieves wind and can prevent digestive upsets such as diarrhea. This is thought to be because these small seeds stimulate the production of pancreatic enzymes that help the body break down foods and absorb the nutrients. This fragrant spice is a source of iron and is rich in essential oils. Regularly eating cumin is associated with blood glucose-lowering effects.

    Chewing a few seeds of cumin sweetens the breath after eating a meal. End a meal by chewing a blend of cumin seeds, fennel, cloves and cardamom to enhance digestion.

  • 6. Fennel - Rich in volatile oils, fennel is a carminative herb, meaning that it can ease bloating, flatulence, and digestive spasms. As well as digestion, scientific research has demonstrated fennel's anti-cancer, intestinal health and eye health benefits. Fennel seeds can also reduce bad breath and body odor. The fennel bulb contains a significant amount of Vitamin C, and is a source of fiber, folate and potassium, making it a powerful antioxidant herb.

  • 7. Mint - mint is widely used as a highly effective digestive aid, and to counteract nausea and vomiting. Mint improves fat digestion and is an effective antacid, due to its essential oils. Peppermint oil is still the basis for many indigestion remedies, because it is extremely soothing to the stomach lining. Mint tea is not only beneficial for digestion; it is a simple treatment for stress-induced headaches. Chewing the leaves or drinking the tea stimulates the cortex of the brain to improve concentration and induce relaxation.

  • 8. Oregano - One tablespoon of oregano has about the same antioxidant capacity as one banana or a cup of string beans. Its antioxidant qualities combat the conditions of aging, especially heart disease and cancers. Oregano contains at least four compounds that soothe coughs and 19 chemicals with antibacterial action, which are associated with offering protection against food-borne diseases. Freshly-picked oregano leaves are the most effective.

  • 9. Parsley - parsley is rich in essential oils, and contains Vitamin A, C, and some iron and calcium. It is a diuretic and digestive herb, helping to prevent problems such as kidney stones and bladder infections, and keeping the body's plumbing running smoothly by causing it to produce more urine. It also aids in the elimination of uric acid - useful for arthritis, rheumatism or gout, and it is an effective breath freshener because it contains high levels of chlorophyll.

  • 10.Fenugreek - fenugreek is rich in vitamins A and C, and iron and phosphorus. Studies have shown that fenugreek is a potent stimulator of breast milk production in nursing mothers. Fenugreek seeds have also been found to protect against cancers of the colon and breast, and have anti-diabetic effects. The regular intake of fenugreek seeds helps to purify the blood, flush out harmful toxins and lowers the risk of a heart attack.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use