Thursday, 17 May 2012    HomeAbout UsContact Us    









You are here: Home Nutrition
Vitamin C: An Amazing Super-Nutrient With Powerful Healing Properties
Posted by SoundHealth, in Nutrition
Topics: Vitamin C Cancer Heart Disease

  Mail To Friend    Printer Friendly Bookmark and Share

Vitamin C in a wonder nutrient that has powerful antioxidant properties. It naturally protects every cell in the body from damage caused by free radicals that are by-products of pollution and other chemical processes. Among the benefits of this amazing nutrient is the way in which it increases natural resistance to infection and protects against degenerative diseases like cancer.

Though it's by far the easiest nutrient to get in the diet, most people barely get enough Vitamin C each day. Vitamin C is a water-soluble vitamin found in virtually every variety of fruit and vegetable.

Numerous studies have shown that Vitamin C protects against infections like colds and the flu, arthritis, and long-term Vitamin C deficiency is associated with heart disease, strokes and cancer.

Vitamin C and disease

Dr linus pauling, known as the 'Father of Vitamin C' declared that daily intakes of Vitamin C complex aided anti-cancer activity and assisted in repairing damaged arteries and removing arterial plaque (atherosclerosis).

An associate of Pauling's, Dr Mathias Rath wrote:

"Animals don't get heart attacks because they produce Vitamin C in their bodies, which protects their blood vessel walls. In humans, unable to produce Vitamin C (a condition known as hypoascorbemia), dietary vitamin deficiency weakens these walls. Cardiovascular disease is an early form of scurvy. Clinical studies document that optimum daily intakes of vitamins and other essential nutrients halt and reverse coronary heart disease naturally. The single most important difference between the metabolism of human beings and most other living species is the dramatic difference in the body pool of Vitamin C. the body reservoir of Vitamin C in people is on average 10 to 100 times lower than the Vitamin C levels in animals."

A long-term Vitamin C deficiency is reported to lead to atherosclerotic deposits in arteries walls, which cover the gaps caused by the disintegrating collagen, resulting in coronary heart disease, as well as strokes to the brain.

Dr GC Willis demonstrated that Vitamin C complex could reverse atherosclerosis. He gave a sample of his patients 1.5 grams of Vitamin C a day and gave the remainder no Vitamin C at all. After a year, the atherosclerotic deposits in the patients fed the Vitamin C had decreased in 30% of the cases. In contrast, no reduction in deposits was observed in the control group, which had grown further. Despite this clear evidence of vitamin C's amazing healing benefits shown over 40 years ago, no follow-up study was ever commissioned.

Further studies conducted by Professor Gey from Switzerland, which compared the Vitamin C, Vitamin A (Beta-carotene) and cholesterol intakes of citizens living in Northern Europe which those living the southern regions of the continent, found that:

  • Those living in the northern nations had the highest levels of cardiovascular disease and lowest blood levels of vitamins.

  • Southern European populations had the reverse statistics and were much more healthier.

Optimum intakes of Vitamin C, E and A had far greater impact on decreasing risks of cardiovascular disease than the reduction of cholesterol, which is now increasingly being viewed as a secondary factor in heart-disease risk, and is the inevitable result of the deficiency of nutrients leading to the break-down of arterial walls.

This report also highlighted a diet rich in bioflavonoids (part of the Vitamin C complex) and Vitamin E as a main preventative measure for heart disease. Further studies show these nutrients separately produce impressive results for cardiovascular disease prevention:

  • Vitamin C intake lowers cardiovascular disease by 50%

  • Vitamin E lowers cardiovascular risk by one-third, documented in 87,000 study participants over six years

  • Beta-carotene (Vitamin A) intake lowers cardiovascular risk over 30%, documented in more that 87,000 study participants over six years.

Also, when these nutrients were combined with other synergistic compounds like magnesium, vitamin B3, vitamin B5 and the amino acid carnitine, and levels of these maintained in the body over the long-term, almost total prevention of heart disease was achieved, and in those already suffering from cardiac problems, their conditions were consistently seen to be reversed.

Studies show that when Vitamin C is given intravenously (through a vein) in mega-doses, it is selectively toxic to cancer cells, with no major side effects. The treatment is thought to work by producing large amounts of hydrogen peroxide at the cancer site (massive oxygen), and it is given directly into the bloodstream to guarantee absorption. Vitamin C is not stored in the body so toxicity is very rare.

More and more practitioners are recommending large doses of Vitamin C for everything from infections and arthritis to heart disease and cancer.

Several studies have suggested that Vitamin C may reduce levels of lead in the blood. Studies have shown that people with elevated blood serum levels of Vitamin C had lower levels of blood toxicity. An examination of the data from the Third National health and nutrition Examination Survey (NHANES), enrolling nearly 20,000 people found a correlation between low serum ascorbic acid levels and elevated blood lead levels. The authors conclude that high ascorbic acid (Vitamin C) intake may reduce blood lead levels. [1]

Good Sources

Vitamin C is not one nutrient but a complex mix found commonly in fruits, vegetables and many other foods. Vitamin C is best absorbed when eaten with good sources of bioflavonoids. These are a large group of naturally occurring chemicals found in many fruits and vegetables. In citrus fruits, for example, they are present in the pith between the skin and the flesh. The highest concentrations are in the most brightly colored produce. Bioflavonoids improve the body's absorption of Vitamin C, and this is helped even more by eating foods containing calcium and magnesium.

Vitamin C is water-soluble so it can't be stored for long in the body and therefore needs to be taken on a daily basis. It is easily destroyed by cooking and food processing, meaning that in all cooked meals, 100% of the Vitamin C content has been destroyed. Humans cannot make Vitamin C in their bodies, unlike most mammals, so our only source of this valuable nutrient is through diet.

Fruits high in Vitamin C are blackcurrants, papaya, strawberries, blackberries, kiwi fruit, citrus fruits mango, guava, melon and pineapples.

Good vegetables sources are asparagus, peppers and all green leafy vegetables.

References

  • [1] Simon JA, Hudes ES "Relationship of ascorbic acid to blood Lead Levels" Journal of the American Medical Association, 1999;281:2289-2293.

  • [2] Hickey Steven and Hilary Roberts, Ascorbate, Lulu, 2004.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
Why We Need Protein in our Diets
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use