Friday, 10 February 2012    HomeAbout UsContact Us    









You are here: Home Body
Nutrients and Superfoods for Healthy Skin
Posted by SoundHealth, in Body
Topics: Skin Antioxidants Vitamin A Beta-carotene Lycopene Vitamin C Vitamin E Protein Omega-3 Omega-6 Omega-9 Selenium Silica Zinc Resveratrol

  Mail To Friend    Printer Friendly Bookmark and Share

Good nutrition is essential for a healthy body, and the skin is a visible sign that our body is healthy from the inside. Good food choices can help to combat ageing skin and transform a dull complexion, making you feel healthier and more energetic, inside and out.

Here are some essential nutrients for youthful and healthy-looking skin; these nutrients form the key building blocks to all superfoods.

antioxidants

Antioxidants help repair the damage to our body cells. They are found naturally occurring in plant foods, like fruit and vegetables.

They are called antioxidants because they prevent oxidation. This is a chemical reaction that occurs by free radicals joining together and damaging our body cells and tissues. We are constantly being bombarded with free radicals from polluted air, water and food, and our bodies produce them when we get stressed.

The best antioxidants for healthy skin are:

Vitamin A

This vitamin is essential for reproduction and maintenance of tissue in skin. It is fat soluble, so it can be stored in the body.

Vitamin A comes in two forms: retinol (an 'animal' form found in meat, fish, eggs and dairy), and Beta-carotene (found in yellow, orange and red fruit and vegetables).

Beta-carotene is a natural pigment (carotenoid), and it neutralizes free radicals, therefore protects the skin's cell structure, and can slow down the effects of ageing. It is great at boosting the immune system and protecting against damaging and ageing illnesses.

Good sources of Beta-carotene include carrots, apricots, sweet potatoes, kale, spinach, pumpkin.

lycopene is another carotenoid that occurs naturally in fruits and vegetables. It is a red pigment useful for protecting the skin against degenerating, keeping the mind alert and the body functioning.

Good food sources are tomatoes (cooked tomatoes have more lycopene than uncooked), watermelons, pink grapefruit, guava and red peppers.

Vitamin C

Vitamin C is needed for collagen and bone formation, and development of connective tissue. It also helps speed up production of new cells, keeps blood vessels healthy and boosts the immune system. This vitamin is water-soluble so it can't be stored for long in the body and therefore needs replenishing daily. It is also easily destroyed by cooking and food processing.

Good sources are asparagus, broccoli, cabbage, blackberries, grapefruit, kiwi fruit, peppers, melon and many other fruits and vegetables.

Vitamin E

This is one of the most effective antioxidants; it attacks free radicals to prevent tissue and bone damage, and thereby protects skin. It also helps the body to use oxygen properly, and maintains healthy muscles and nerves. Some Vitamin E is stored in the liver, and in fat and muscle tissues, but it does need to be replenished regularly.

Good food sources are almonds, hazelnuts, peanuts, pistachios, sunflower seeds, avocados.

Resveratol

This is a natural chemical, or flavanoid, found in fruits. It protects the body against inflammation and boosts the immune system. It has shown to decrease the ageing of the DNA in the mitochondria, the energy plant of the cells.

Blueberries contain four times the amount of resveratol found in other fruits, and usually the darker the skin of the fruit, the more resveratol in contains.

Other good food sources include cranberries and grape skins.

protein

Protein is the second major component of our body, after water. We need protein for our skin to create collagen (the main structural protein of the skin), muscles, hormones, antibodies, enzymes and nerves.

Proteins are built from a combination of 22 amino acids, and eight essential amino acids must be present in the body for protein manufacture to take place. Therefore the quality of the protein is essential, not the quantity.

High-quality protein sources include fish, meat, eggs, dairy products, soya, nuts, seeds, whole grains.

A lack of protein in the diet could result in rough skin, brittle nails, thinning hair, poor muscle tone and wrinkles.

Essential fatty acids

These are the fatty acids omega-3, omega-6 and omega-9. They are important for healthy skin and bodies, as they are used to build cells walls and have an anti-ageing effect on skin.

Our bodies can't manufacture omega-3 and omega-6, so we need to get them from food.

Good food sources of omega-3 are flax seed (oil and nuts), hemp seeds, fish, walnuts, brazil nuts, avocados and dark green leafy vegetables.

Food sources of omega-6 include olives and olive oil, chicken, seeds nuts, fruits, grains, pumpkin.

Omega-9 is technically not an essential fatty acid, as our bodies can manufacture a certain amount, as long as enough omega-3 and omega-6 are present. It contains oleic acid, and an excellent food source is extra virgin olive oil, which contains 75 percent oleic acid.

minerals

Minerals are essential for pretty much every body process, and they help to regulate and balance our body chemistry.

Selenium

This is a trace mineral so only small amounts are needed daily. It is a great antioxidant and boosts energy levels. Organic food has found to have higher selenium levels than other kinds.

Good food sources include sesame seeds, brazil nuts, sunflower seeds, tuna and garlic.

silica

Silica is present in our skin, hair and nails. It is essential for the formation of white blood cells. Clinical trials have shown that silica can help thicken the dermis (an inner layer of skin), increase skin elasticity and repair brittle and cracked nails. It also helps the skin to store moisture, plumping and smoothing it.

zinc

This is another trace element, and is essential for insulin production, the production of new collagen, and for protecting and repairing DNA. A zinc deficiency could result in brittle, cracked nails, damages hair, slow healing of wounds and acne.

Good food source include oysters, sardines, pumpkin seeds, eggs and liver.


Link to this article:   Show: HTML LinkFull LinkShort Link
Share or Bookmark this page: You will need to have an account with the selected service in order to post links or bookmark this page.

                 
  
Subscribe via RSS or email:
Follow us through RSS or email. Click the RSS icon to subscribe to our feed.

     

Related Articles:
Add a Comment
You must be registered and logged in to comment.





Visit Vaccines.Me for information and education on vaccination.


Topics
General
Nutrition
Disease
Body
Mind
Fitness
Weight Loss
Pregnancy
Children
Recipes
Prophetic Medicine
News

Latest Articles
End the War on Fat: It Could Be Making Us Sicker
Chia Seeds: An Excellent Source of Omega-3 Fats and More
Some Amazing Facts About Sweet Potatoes
Eating Fish Reduces Risk of Alzheimer's Disease, Study Finds
Artichoke Leaf Extract Reduces Symptoms of Irritable Bowel Syndrome and Improves Quality of Life Dyspepsia Sufferers
Phenolic Compounds From the Leaf Extract of Artichoke (Cynara Scolymus L.) and Their Antimicrobial Activities
Artichoke Leaf Extract Reduces Mild Dyspepsia in an Open Study
The Mineral Selenium and Its Anti-Tumor Properties
Imaam Al-Shaafi'ee on the Importance of Learning Medicine
What Are Probiotics and Prebiotics and Why They are Vital For a Healthy Gut

Pages
No pages found.

Most Popular
How To Eat Fruit Properly
Garlic, Honey and Apple Cider Vinegar: Must Have Excellent Home Remedy
Five Superfoods You Should Be Eating Everyday
Deodorant And Anti-Perspirant Dangers - Do You Know What You're Putting Under Your Armpits?
What Foods Are Good For Your Eyesight?
Foods for Healthy Hair
The Different Kinds Of Exercises Your Body Needs
Flax Seed, Black Seed Oil and Honey Oat Porridge - Absolutely Great For Your Health
Are You Drinking Living Milk Or Dead Milk?
Why We Need Protein in our Diets

Archives (View more)
2012 • January
2011 • December
2011 • November
2011 • October
2011 • September
2011 • August
2011 • July
2011 • June
2011 • May
2011 • April
2011 • March
2011 • February


Key Topics
acidacid alkaline balanceacneacrylamideadditivesadrenalinaerobic exerciseageingage-related macular degenerationagingairair fresheneralfalfaalfalfa sproutsalkalineallergiesallergyallicinalmondsaloealoe veraalopeciaalpha-caroteneal-shafi'ial-tibb al-nabawialum stonealuminiumalzheimer'samino acidsanaemiaanthocyanidinsanthocyaninsanti-agingantibacterialanti-bacterialantibioticantibioticsantifungalantimicrobialanti-microbialantiobioticantioxidantantioxidantsanti-perspirantantisepticantiviralanxietyappendicitisappleapple cider vinegarapricotapricotsarthritisartichokearugulaascorbic acidasparagusaspartameassimilationasthmaatopic dermatitisaubergineautismavocadoavocadosbabiesbacteriabananabarleybarley grassbasilbathroombeansbee pollenbeesbeetbeetrootbeetsberriesbeta-carotenebeveragesbioflavonoidbioflavonoidsbisphenol abitter melonblack pepperblack seedblack seed oilblack teablackberriesblackcurrantbloodblood pressureblood sugarbloodlettingblueberriesblueberryblue-green algaebodybody phbone healthbonesborage oilbowel cancerbrainbrain cancerbrazil nutbreadbreast cancerbreast feedingbreastfeedingbreathingbroccolibromelainbrown ricebrussel sproutsbrussels sproutsbuckwheatbudwig protocolburnsbutterbutternut squashcabbagecacaocaffeinecalciumcaloriescamel's urinecancercandidacandida albicanscandidiasiscantaloupe meloncarbohydratecarbohydratescarcinogenscardamomcardiovascularcardiovascular diseasecarobcarotenoidscarpal tunnel syndromecarrotcashew nutcataractscauliflowercavitiesceleriaccelerycell phonechamomilechardchdcheesecherrieschia seedschickpeaschicorychildrenchili pepperchillichlorellachlorophyllchocolatecholesterolcholestrolchromiumchronic illnesscilantrocinnamoncitroncitrus fruitclarified buttercleanerscloveclovescocoacoconutcoconut oilcodex alimentariusco-enzyme q10coffeecolacoldcold flucold sorecoldscoliccolon cancercolorectal cancercombining foodscommon coldcompostconcentrationcondimentscontagioncookwarecoriandercorncos lettucecottage cheesecoughcough medicinecourgettecouscouscranberriescresscruciferouscruciferous vegetablescucumbercumincuppingcurcumincuredandruffdark chocolatedatesdehydrationdementiadeodorantdepressiondetoxdetoxifyingdhadiabetesdietdigestiondigestive cyclesdipsdiseasedopaminedried fruitdry cuppingdry eyesdry skindust mitesdyspepsiaeating habitsechinaceaeczemaeggeggplanteggsemfendiveenergyenergy saving light bulbsenzymesepaesophageal canceressential fatty acidsessential oilexcitotoxinexerciseeye exerciseseye healtheyesightfalafelfastingfatfatsfatty acidfatty acidsfennelfenugreekfermentationfertilityfiberfibrefigfishfitnessflavonoidflaxflax oilflax seed oilflax seedsflaxseed oilfluflu vaccinefluoridated waterfluoridationfluoridefluoride-free toothpastefluorosisfolatefolic acidfood additivesfood combinationfood combiningfood digestibilityfood poisoningformaldehydefree radicalsfructosefruitfungal infectionsgalengarbanzo beansgardeninggarlicgenisteingenotoxingheegingerginsengglucosamineglucoseglutamineglutathioneglycationglycemic indexgoji berrygoutgraingrainsgrapefruitgrapesgray hairgreen beansgreen leafy vegetablesgreen teaguavagum diseasegumshairhair losshappinessharirahazelnutheadachehealinghealthheartheart attackheart diseaseheart healthheartburnheart-diseaseheavy metalshennahepatitis bherbshigh blood pressurehigh fructose corn syruphigh fructrose corn syruphijaamahhijamahimalayan crystal salthinahippocrateshomogenized milkhoneyhormoneshousehold productshouseplantshummushyperactivityhypertensionimmune systemindigestioninfectioninfectionsinfectious diseaseinfertilityinflammationinflammatory responseinfluenzainsomniaintelligenceintestinesintoxicantsiqironirritable bowelirritable bowel syndromejohanna budwigjointsjuicejuicerjunk foodkalekidney diseasekiwikiwifruitlactic acid bacterialactobacilli plantarumlavenderlawsonia inermisleekslegumeslemonlemon-grasslentil souplentilslifespanlimelinseedlinus paulinglive longliverlong lifelonger lifelongevitylung cancerluteinlycopenemagnesiummaizemangomanuka honeymargarinemarjorammeatmedical industrymedicinal treatmentmedicinemelonmemorymenopausemenstruationmental healthmercurymetabolismmigrainemigrainesmilkmilletmindmineralmineralsmintmiswakmmrmobile phonemoldmonosaturated fatmonosodium glutamatemonounsaturated fatmonounsaturated fatsmoodmouthmsgmusclemusclesmushroommustardmustard seedsmyrtlenailsnatural healthnatural medicinenauseanervous systemneurotoxinnigella sativanigella seedsnight shiftnutnutmegnutritionnutritional deficiencynutsoatsobeseobesityoilolive oilolivesomega-3omega-3 fatty acidsomega-6omega-9oniononionsoracorangeoreganoorganicorganic gardeningorganic honeyosteoarthritisosteoporosisovarian canceroverweightoxidantspancreatic cancerpapainpapayaparabensparkinson's diseaseparsleypassion fruitpastapasteurizationpasteurized milkpatiencepeanutspearpeaspecan nutpecan nutspeppercornpeppermintpeppersperfluorinated chemicalsperppermintpersonal carepersonal care productspesticidespestspfoaphpharmaceutical industryphenylalaninephosphatephospholipidsphosphorusphytochemicalsphytonutrientspine nutpineapplepistachio nutplumspollutionpolyphenolspolyunsaturated fatpolyunsaturated fatspolyunsaturated fatty acidspomegranatepomegranate juicepopcornporridgepostnatal depressionpostpartum depressionposturepotassiumpotatopotatoesprebioticprebioticspregnancypremenstrual syndromeprobioticprobioticsprophetic medicinepropolispropylene glycolprostate cancerproteinprunespsoriasispufapulsespumpkinpumpkin seedsquarkquincequinoaqur'aanquranradiationradishraisinsramadanrapid eye movementraspberriesraw honeyraw milkred blood cellsred cabbagerefined grainrespiratory problemsresveratrolretinolrhubarbricericketsrocketromaine lettucerooibus tearosemaryroyal jellyrunningsaffronsagesaladsalmonsaltsaturated fatsaturated fatssauerkrautschizophreniaseedsseleniumsemolinasennaserotoninsesame oilsesame seedsshellfishsilicasinusitissiwakskeletonskinskin cancerskincareskippingsleepslssnacksodasodiumsodium benzoatesodium fluoridesodium lauryl sulfatesoft drinkssoupsour cabbagespicesspinachsprirulinasproutsproutingsproutssquashst johns wortstarchstimulantsstrawberriesstressstrokesucralosesucrosesugarsulfur dioxidesulphursunsunflower seedssunlightsuperfoodssupplementssweet potatosweetcornsweetenerswine fluswiss chardtahinitalbinatangerinetaste budsteatea tree oilteethteflontendinitistension headachethimerosalthinkingthyroid diseasetomatotooth decaytoothpastetoxictoxic chemicalstrace elementstrace mineralstrans fattriclosanturmerictype 2 diabetestype-1 diabetestype-2 diabatestype-2 diabetesubiquinolunlawful medicineunpasteurised milkvaccinationvaccinationsvaccinevaccine damagevaccinesvegetablesvinegarviral infectionsvisionvitaminvitamin avitamin bvitamin b12vitamin b6vitamin cvitamin dvitamin evitamin kvitaminswalkingwalnutwaterwater fluoridationwater fluoridatoinwatercresswatermelonweightweight gainweight losswet cuppingwheatwheatgermwheatgrasswhole grainwhole grainswild salmonwinteryeat overgrowthyoghurtzeaxanthinzinczucchini
Copyright © 2012 . All rights reserved. RSSTagsPrivacyLegal and Terms of Use